current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: TM0015 TM0015 281896 PDB-2007-09-14, from JCSG0516

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 -102.000TM0015 TM0015 281896 PDB-2007-09-14  ali  100  1MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE 192
2 -62.500TM0406 TM0406 282279 Purified-2001-12-06  ali follow..  24  1...MTEPVSIRIAGISGQGNILAGLILAKALVYEGKWVVQTQSYSAQVRGDVSYCDVLYDDSPIDYP-ESEYFDIVCILHQKAMDE-LYKSVKVNGVVILDQTFVKNVPDFVKRITRKILFVPATERAISEFKTAVSNVIMVGVLAKVCNIVKLDSLKRALKDHVRRP----LWDINLKALEFGYNMFEKQ. 183
3 -23.700TM1164 TM1164 283030 Purified-2001-11-13  ali follow..  21  4.......VSIVLSGEAGQGIQTVENVLTRVLKDSGFHVFATKEYMSRVRGGNNTTEIRVSSRRVRSFV--DRIDVLIPLGKGATERL-KNRITEKTLVIGEEEFIKES-------PGEKIVIPFLNIAKQIGKSIYANSVAIGFLSGLLG-ADESALKDQITRQFSSK-GEDIVNDNIRAALEGYKKGQELS 176
4 -8.550NT1291D NP_070513.1 378820 Purified-2007-08-28  ali follow..  14  1.......MKIAISGKGGVGKTTLAATLAYLFARDGYRVTAIDCLGVKEKPKPLSELHEIIEKRVVGPMGTYKLNPKVVYNEDGVRVLVLGTIEKGGVLILDMEAGIEHLGR-----GTARGVDLLIAVVEPGTRAVETLERIEKLGRDIGIERIAVVVNKFIESERARELISGIKYPILGVIHYDQCFVRAD 221
5 -7.600MI7862F NPUN_22DEC03_CONTIG1_REVISED_GENENPF3920 399286 Purified-2009-08-31  ali follow..  10  18...IEEKAEYKSEYRDGEIVPMTGGTTNHNKIALNLAA----SLKIALRRKNYDVYIGDVRLWIPRYRQHTYPDVMVIEGQPIYTGTSTTTVMNPVLIAEVLSKSTKNYDQGDKFLYEYILIDQSQYHVMHYVKTAESQWSFTELEHESAILSLQTVDFKIE.............................. 180
6 -7.600PK9982A YP_910084.1 388978 Purified-2008-05-27  ali follow..  12  1......MIISVINLKGGSGKTTTAMALATAAARHNRNVSVLDT---DPQGDATTWAGDAEDAGETLPFTVDSANILVIIDCPPAGNVVDVACDVSDFVIVPATQGPFELSHALET---AESLDAAGKPYALLLLKVENNKLAGNAVNLIRERGASVFDASVPKR............................ 166
7 -7.520FM11607A YP_612366.1 377904 PDB-2008-02-13  ali follow..  24  24.........VALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDG-PRKGAPFEGFQRL--HALKHQERVIYPLFDRARDIAIVGPECRVAIIEGNYLLFDAP......................................................................................... 138
8 -7.110MI7862E YP_321960.1 399270 Purified-2009-07-28  ali follow..  18...LEEKAEFRSEYRNGEIIPMTGGTTNHNKIALNTAF----ALKSALRAQDYEIYMADVRLWLPRYQQYTYPDVMVIQGEPVYAGTNTTTVTNPSLIVEVLSKSTKNYDQGDKFHYEYILIDQYQHHVMKYVKTAADQWLFTELESDSATLSLSTVDLQIS.............................. 180
9 -7.100FL11125A YP_048978.1 375886 Crystal|NMR-2007-07-06  ali follow..  10  1..MAAELKTITVLGAGGKGMRISANFQKSDYQVFYCENSPRAQEQVVAAGRELSI----------AEQVIPESDVVILAVPKAVSGIVVPQMKSNAVLLTLDPAAAYANLIAKRDDIDYAVAPCHPSVFLDRFTPEEHADAFGGVAAPQHVA........................................ 146
10 -6.790SP5574C ZP_01959777.1 406827 Selected-2009-11-12  ali follow..  14 1085........ELYVFKVPGTASYLQGDINNDGKIDRNDLTSYMNYTGLRRGDSDYEGYISKGD--INMNDLIDAYDISVVATQLEGGVGRKDTLKVSGSLSISTPKRLYQKDEIVEIRVKLKAVNALSFALPYDQNDFVEPLNMKAMENLTYDRLHTNGVKSLYPTFVNIGKQEALNGSEELFVLKLKAKRKVK 1273

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.