current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: TM0002 TM0002 281883 Purified-2001-08-29, from JCSG0516

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -5.680tr|F8VX55|F8VX55_HUMAN Uncharacterized protein OS=Homo sapiens GN=TFCP2 PE=4 SV=1 (Range: 1-54)  ali follow..  27  22...........FDASLSGIGQELGAGAYSMSDVLALPIFK. 50
2 -5.680sp|Q12800|TFCP2_HUMAN Alpha-globin transcription factor CP2 OS=Homo sapiens GN=TFCP2 PE=1 SV=2 (Range: 1-54)  ali follow..  27  22...........FDASLSGIGQELGAGAYSMSDVLALPIFK. 50
3 -5.660sp|Q9NZI7|UBIP1_HUMAN Upstream-binding protein 1 OS=Homo sapiens GN=UBP1 PE=2 SV=1 (Range: 1-53)  ali follow..  27  19...........FDASLSGIGQELGAGAYSMSDVLALPIFK. 47
4 -5.570sp|Q12766|HMGX3_HUMAN HMG domain-containing protein 3 OS=Homo sapiens GN=HMGXB3 PE=2 SV=2 (Range: 1469-1518)  ali follow..  25  9.....YNRLMDFLTSREIVNRQIHDIVQSCQPGEVV..... 39
5 -5.530sp|A6NFK2|GRCR2_HUMAN Glutaredoxin domain-containing cysteine-rich protein 2 OS=Homo sapiens GN=GRXCR2 PE=3 SV=1 (Range: 96-154)  ali follow..  11  20.PIIDFGKIIIYTNNLKIIRTPMDKRD.............. 45
6 -5.230sp|Q6Q759|SPG17_HUMAN Sperm-associated antigen 17 OS=Homo sapiens GN=SPAG17 PE=1 SV=1 (Range: 1-77)  ali follow..  27  27FNQNDWQASIAFVVGNQIEDDLLIQA---LTVAVQVPQRK. 63
7 -4.830sp|P14316|IRF2_HUMAN Interferon regulatory factor 2 OS=Homo sapiens GN=IRF2 PE=1 SV=2 (Range: 136-225)  ali follow..  30  66................QVVEVTTESDEQPVSMSELYPLQ.. 88
8 -4.460sp|Q9H8M5|CNNM2_HUMAN Metal transporter CNNM2 OS=Homo sapiens GN=CNNM2 PE=1 SV=2 (Range: 66-120)  ali follow..  12  1VGENEETVIIGLRLEDTNDVSFMEGGALRVSERTRVKLRVY 41
9 -4.260sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 (Range: 1145-1201)  ali follow..  36  4.............VSAECLGPPLDISTKNITKSLA...... 25
10 -3.960sp|Q86UB9|TM135_HUMAN Transmembrane protein 135 OS=Homo sapiens GN=TMEM135 PE=2 SV=2 (Range: 224-286)  ali follow..  12  16......RHRCCKHYEDNCISYCIKGFIRMFSVGYLIQC... 47

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.