current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: TM0003 TM0003 281884 Purified-2001-12-06, from JCSG0516

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -4.970sp|Q9NYP8|CU062_HUMAN Uncharacterized protein C21orf62 OS=Homo sapiens GN=C21orf62 PE=1 SV=2 (Range: 160-219)  ali follow..  26  20.SAFKSYSIENVTSIANN-DFSYFRTFPMPSNKSYVVTF. 58
2 -4.450sp|Q2M243|CCD27_HUMAN Coiled-coil domain-containing protein 27 OS=Homo sapiens GN=CCDC27 PE=2 SV=2 (Range: 118-199)  ali follow..  40  1................FMSKMELRRVFPQFSTRATSMS.. 28
3 -4.010sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 (Range: 191-259)  ali follow..  18  33........FTKMAIYGYRHPLELWSLKEEDRSQMVVQQLL 67
4 -4.010tr|B4DZU4|B4DZU4_HUMAN Uncharacterized protein OS=Homo sapiens GN=C11orf65 PE=2 SV=1 (Range: 162-246)  ali follow..  20  13.DSVMEWEVDEV-TLNFDEYIASWKEIATSNSSANFKGIF 55
5 -3.990sp|O14497|ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens GN=ARID1A PE=1 SV=3 (Range: 1814-1866)  ali follow..  16  23...............EFDSGLLHWRIGGGDTTEHIQTHFE 47
6 -3.990tr|B1P2N7|B1P2N7_HUMAN Numb isoform 7 OS=Homo sapiens GN=NUMB PE=2 SV=1 (Range: 287-349)  ali follow..  22  37.....PYPAPNVPVVGITPSQMVANVFGTAGH........ 63
7 -3.990sp|P49757|NUMB_HUMAN Protein numb homolog OS=Homo sapiens GN=NUMB PE=1 SV=2 (Range: 482-544)  ali follow..  22  37.....PYPAPNVPVVGITPSQMVANVFGTAGH........ 63
8 -3.950sp|Q8NCR3|CK065_HUMAN Uncharacterized protein C11orf65 OS=Homo sapiens GN=C11orf65 PE=2 SV=1 (Range: 211-313)  ali follow..  23  13.DSVMEWEVDEV-TLNFDEYIASWKEIATSNSSANFKGFR 55
9 -3.610sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=1 SV=1 (Range: 1985-2108)  ali follow..  33  5...IKVYEIDDVERL......................... 16
10 -3.570sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 (Range: 193-262)  ali follow..  18  32........ITGLIVRGYRQPLELWSLNKEDTSEQVVPVLV 66

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 8 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.