current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: TM0004 TM0004 281885 Purified-2004-07-19, from JCSG0516

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30
# Score Template Links and tools%idFirst MKDLYERFNNSLEVWKLVELFGTSIRIHLFQLast
1 -6.040sp|Q56UN5|YSK4_HUMAN SPS1/STE20-related protein kinase YSK4 OS=Homo sapiens GN=YSK4 PE=1 SV=1 (Range: 622-678)  ali follow..  23  26.SDMFKEINSTANGPGIYEMFGTPVYCHVRE 55
2 -4.720sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 (Range: 782-845)  ali follow..  46  52...IYNRINNDLLMWE............... 64
3 -4.510sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens GN=ATG2B PE=1 SV=5 (Range: 906-973)  ali follow..  37  49YEKLYNRIFNDLLLWE............... 64
4 -3.960sp|Q13459|MYO9B_HUMAN Myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 (Range: 1301-1356)  ali follow..  26  4.....ERLASAVELWRGKKLVAAA....... 22
5 -3.650sp|Q96IK0|TM101_HUMAN Transmembrane protein 101 OS=Homo sapiens GN=TMEM101 PE=1 SV=1 (Range: 203-257)  ali follow..  30  22....YWHNTRRVEFWNQMKLLGESVGI.... 44
6 -3.450sp|Q8NI27|THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens GN=THOC2 PE=1 SV=2 (Range: 431-567)  ali follow..  27  77............ELWGMFKTFPYQHRYRLY. 94
7 -3.300tr|C9JT10|C9JT10_HUMAN Uncharacterized protein OS=Homo sapiens GN=ACSL6 PE=4 SV=1 (Range: 41-100)  ali follow..  16  14ARTMYQVFRRGLSISGNGPCLGFRKPKQPYQ 44
8 -3.210sp|Q9NQW6|ANLN_HUMAN Actin-binding protein anillin OS=Homo sapiens GN=ANLN PE=1 SV=2 (Range: 805-884)  ali follow..  29  64LQDVSNDFEINIEVYSL.............. 80
9 -3.060sp|Q8TDI8|TMC1_HUMAN Transmembrane channel-like protein 1 OS=Homo sapiens GN=TMC1 PE=1 SV=2 (Range: 460-514)  ali follow..  28  2...LMDEINNKIEEEKLVKANITLWEANMIK 29
10 -2.990sp|Q9UH92|MLX_HUMAN Max-like protein X OS=Homo sapiens GN=MLX PE=1 SV=2 (Range: 236-298)  ali follow..  32  11MDSLFQSFNASISVASFQELSACVF...... 35

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 1 8 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.