current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: TM0014 TM0014 281895 Purified-2001-01-30, from JCSG0516

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MREREIVDKLTSAFFAENTIISFTSQLDEALTRKLRRMQRRIEEVKERFVNLNRLFQELVGDFQAKSDQLVSVIQDMEKISENIMEELKKSGTNVDQIVERVKEASSQIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNETNEVTKQIVEKAREILESSQRSLENLEFMANLFETVGKTLQNMVRFMENNVKLLQEVRNSLDTSKESLSEKSAEIDSATKVLEETAGGFTTINRVINSVITAQRKLKDLKILast
1 -7.880sp|Q8TD57|DYH3_HUMAN Dynein heavy chain 3, axonemal OS=Homo sapiens GN=DNAH3 PE=2 SV=1 (Range: 234-801)  ali follow..  10  344......................................................TVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQIEDIFDNSRNLLLHKRDQAEMLIKRCSEFELRLEGYH.... 568
2 -7.300tr|E7EQE5|E7EQE5_HUMAN Uncharacterized protein OS=Homo sapiens GN=DNAH3 PE=4 SV=1 (Range: 191-685)  ali follow..  219...DGCWELIRDSFLEIIKNSNGIPKVESVLFPELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITV-----PLAMFCLDA--TALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYEDIKLNSTLFLWPDQIEDIFDNSRNLLLHKRDQAEM...... 480
3 -7.090sp|Q15111|PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens GN=PLCL1 PE=1 SV=3 (Range: 874-1059)  ali follow..  7................................................................................LKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCPPIASLKQCLLTLSSRLITSDNTPSVSL-----VMKDSFPYLEPLGAIPDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLAC............... 186
4 -6.850sp|Q9UPR0|PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens GN=PLCL2 PE=1 SV=2 (Range: 910-1092)  ali follow..  1.............................................................................TLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELLSSVANLMQCMLAVSPRFLGPDNTPLVVL-----NLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAA............... 183
5 -6.450sp|Q5T1A1|DCST2_HUMAN DC-STAMP domain-containing protein 2 OS=Homo sapiens GN=DCST2 PE=2 SV=2 (Range: 73-229)  ali follow..  9......................................................................................................................................LLLL-----PQAFSRQGRTLLVLQGPCANTLRNFTRASEAVACGAELALNQTAEVLQRAKQLVSALNKIKAIARKTKEVADRVRKFFRSIMDGVKHIARALRNVWQWLLHIGDVCNSE.......................... 129
6 -6.030sp|Q0VDD8|DYH14_HUMAN Dynein heavy chain 14, axonemal OS=Homo sapiens GN=DNAH14 PE=2 SV=3 (Range: 601-867)  ali follow..  60...............AYQNIIVNLLTIIGNSMGLVNAYSHKFIKYCTMTEKAKIMSMKISSMGELTSKEFEAILNRFRNYFRHIVN---AIEKRIGIFNVVVESSLQQLECDPTEIEEFLEHFIFLNAISSKIS--KLEKEFLTMSQ------YSVAKHHQIHISEEQIAIFQVLLLKFSQLKSSMKLSKINKD------TAITKFRDNLEACISGLHVDVGNLKAKIRT................................................ 259
7 -5.840sp|Q6ZR08|DYH12_HUMAN Dynein heavy chain 12, axonemal OS=Homo sapiens GN=DNAH12 PE=1 SV=2 (Range: 191-587)  ali follow..  12  152...............TFQDLEDNVLSLVERIAEALQNVQTIPSWLSGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQE......................................... 378
8 -5.830sp|Q9NSG2|CA112_HUMAN Uncharacterized protein C1orf112 OS=Homo sapiens GN=C1orf112 PE=1 SV=1 (Range: 1-565)  ali follow..  10  11LEQTFFSQVLPKTVKLFDDMMYELTSQARGLSSQNLEIQTTLRNILQTMVQLLGALTGCVQHICATQESIQSLPSSVLHIIKSTFVHCKNSESVYSGCLHLVSDLLQALFKEAYSLDDILNMVIVIHSLLD---ICSVISSMDHAFHANTWKFIIKQSLKHQSIIKSQLKHKDIITSLCEDILFSFHSCLQLAEQMTQSDAQDNADYRLFQKTLKLCRFFANSLLHYAKEFLPFLSDSCCTLHQLYLQIHSKFPPSLYATRISKAHQEEIAGA..... 305
9 -5.260sp|Q96EV8|DTBP1_HUMAN Dysbindin OS=Homo sapiens GN=DTNBP1 PE=1 SV=1 (Range: 44-146)  ali follow..  17..............................................................................................................................................................AALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADL-----------ESMTANLTHLEASFEEVENNLLHLEDLCGQ........................... 98
10 -5.090sp|Q68CZ6|HAUS3_HUMAN HAUS augmin-like complex subunit 3 OS=Homo sapiens GN=HAUS3 PE=1 SV=1 (Range: 442-603)  ali follow..  21............................KELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHL---------LTDILADVKTKRKTLANNKLHQMERE-------DYLKDIVENLETQSKIKAVSLED..................................................................................................... 162

FFAS is supported by the NIH grant R01-GM087218-01
1 2 4 8 3 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Li W, Godzik A. In search for more accurate alignments in the twilight zone. Protein Sci. 2002 Jul;11(7):1702-13.