current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|13507753|ref|NP_109702.1| hypothetical protein MPN014 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MELRNTKLEQLFYIYHRNLKYRCPMQYLTKRGFNLQDLLSVGGGLAYLGEKQWLNLSLYNFNNQLVGFLSRKVGFEKKFLYLPINKPPSKSESFLGLKHLPTETNTIYLVEGDFDWLAFRKGGILNCLPLCGLTLSDKQMKFFQQSKIEKVVLCLDNDFAGKVAAANLERILKNAGFQVKVVQLKGKVKDWNELLLLYPKNWAKALRDHLALLast
1 -66.900IDP90503 DNA primase [Vibrio cholerae O1 biovar eltor str. N16961] NP_230169 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  153.RGLSGEIVQKFGIGYIADEWDLVRRNFGQQRSSEDMLVTAVMGRRYDRFRGRVMFPIRDRRGRVIGFGGRITEQGPKYLNSPETPIFHKGKELYGLYEVYREPPQILVVEGYMDVVALAQYGVDYSVASLGTSTTGDHLQLLFRQ-TNHVICCYDGDRAGRDAAWRALENYLKSGNILKFLFLPDG-EDPDSYVRKYGKAFEQQVANATPL 375
2 -66.100IDP05233 gene: dnaG; DNA primase [Listeria monocytogenes EGD-e] lmo1455 [Listeria monocytogenes EGD-e]  ali follow..  19  150.RGMSEQMMTTFQIGFAPNHHATITSFLEKRGMDLQLAGAAGLGQMVDRFRNRIMFPITNDRGQIIAFSGRLFDRDPKYLNSPETPVFNKRRILFHFSEAIRKQEEITLMEGFMDVISAEEAGVQNAVASMGTSLTEEHADLIKRL-TNRAIICYDGDRAGIEAAYKAGTLLVERRLDVFVLQLPAG-KDPDDFIRASGPEKFKEVYKQQRM 370
3 -65.600IDP90681 gene: dnaG; DNA primase [Salmonella typhimurium LT2] STM3210 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  146.RGLSAEIIQRFAIGFAPPGWDNALKRFGNNSDNKALLLDAGMGSTYDRFRNRVMFPIRDKRGRVIGFGGRVLGNDPKYLNSPETDIFHKGRQLYGLYEASAEPQRLLVVEGYMDVVALAQYDINYAVASLGTSTTADHMHMLFRA-TNNVICCYDGDRAGRDAAWRALETYMTDGRQVRFMFLPDG-EDPDTLVRKEGKAFEARMEQAQPL 368
4 -65.300IDP06259 gene: dnaG; DNA primase [Streptococcus pneumoniae TIGR4] NP_345545 [Streptococcus pneumoniae TIGR4]  ali follow..  19  142.RGLTDEVLKHFWIGLAPPERNYLYQRL-SDQYREEDLLDSGLNQFVDTFHNRIMFPLTNDQGKVIAFSGRIWSQTSKYKNSRSTAIFNKSYELYHMDRASGKASEIYLMEGFMDVIAAYRAGIENAVASMGTALSREHVEHLKRL-TKKLVLVYDGDKAGQAATLKALDEI--GDMPVQIVSMPDN-LDPDEYLQKNGPEDLAYLLTKTRI 360
5 -65.100IDP90594 gene: dnaG; DNA primase [Yersinia pestis CO92] YPO0644 [Yersinia pestis CO92]  ali follow..  19  146.RGLSEEIIQHFAIGFAPPGWDNALKRFGRDGESRTALNDAGMGRTYDRFRERVMFPIRDKRGRVIAFGGRILGDGPKYLNSPETEIFHKGRQLYGLYEAHPNPTRLLVVEGYMDVVALAQFGIDYAVASLGTATTAEHIQLLFRA-TDNVICCYDGDRAGRDAAWRALETYLNDGRQLRFMFLPDG-EDPDTLVRKEGKDFEQRMEAAQPL 368
6 -62.100IDP90712 gene: dnaG; DNA primase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1638 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  26  135.RALNDKDIAKFELGFAGASEDSI-RLLQNQKIPLEDAMSVGANEFYASFIWRITFPIYDHKDLLVGFGGRTLNPNAKYVNSPQNILFDKSRIFYAFNIAIAKKKEIIVCEGYMDAIAFHKAGFNNAVAVLGTALTEHHLPLIRRY-DAKVILCFDNDEAGLKAATRSAFLLSTNKIDGKVAILQGG-KDPAELVAKNESTLHNILDEGIEL 354
7 -31.300IDP06295 primase-like protein [Streptococcus pneumoniae TIGR4] NP_346417 [Streptococcus pneumoniae TIGR4]  ali follow..  15  1...................................................................................................MKEKISQVIVVEGRDDTVNLKRYFDVETYETRGSAINAQDIERIQRLHRHGVIVFTDPDFNGERIRRMIMMVVQHAFLKRDEAVPKSKTKGRSLGIEHASYELKTALAQVTEQ 118
8 -13.000IDP92130 helicase, putative [Toxoplasma gondii ME49] TGME49_061800 [Toxoplasma gondii ME49]  ali follow..  14  316.RGMTLETLRTYGVGCVTLYFSAGQRLRRSKGVSQPGEASDEDCAHSRKDASS------AATLPVVRVKARSISEKSCMRLLPAG----GQWGLFGAATVPADADTLVLTEGEFDAMSVFQQTKVPAVSV-AHSLPVQVLPFLERF--KKIILWMDDDAAGREGAELFAAKL........................................ 530
9 -11.300IDP90939 NMPDR 243277.1.peg.3882 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  157.RGLSGEIVQKFGIGYIADEWDLVRRNFGQQRSSEDMLVTA........................................................................................................................................................................... 196
10 -7.040IDP95167 pyrroloquinoline quinone biosynthesis protein PqqE [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001335473 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  30...................................................................SNPLDFARQDKELTTEQWIEVFRQARAMGSVQLGFSGGEPLTRKDLPELIRARDLGFYTNLITSGIGLTESKLDAFSEAGLDHIQISFQASDEAFQQKLTMAKAVKARDYPMVLVLHRHNIDQLDKIIE................ 172

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24