current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|57116682|ref|YP_177615.1| para-aminobenzoate synthase component II (Rv0013) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTGLPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSALast
1 -85.300[EH] COG0512 Anthranilate/para-aminobenzoate synthases component II  ali follow..  50  2..ILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDAL--KPQKVVISPGPCTPDEAGISLDVIRHYAG-RLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLANPLTVTRYHSLVVEPDSLPACFEVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQLLANFLH.......................................... 186
2 -76.700[E] KOG0026 Anthranilate synthase, beta chain  ali follow..  42  19GPIIVIDNYDSFTYNLCQYMGELQCHFEVYRNDELTVEELKRK--NPRGVLISPGPGTPQDSGISLQTVLELGP-LVPLFGVCMGLQCIGEAFGGKIVRSPFGMHGKSSMVHYDEEGLFSGLSNPFIVGRYHSLVIEKDTFPDELEVTAWTEDGVMAARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKDSEKLT............................... 222
3 -75.400[F] COG0518 GMP synthase - Glutamine amidotransferase domain  ali follow..  23  9.RILILDFGSQYTQLLARRVREIGVYCELWAWD---VTEAQIREFNPSGIILSGSPESTIENG-SPRAPDYVFTAGVPVLGVCYGMQTMAIQLGGKVESSNQREFGYAQVEIKADSALIRDIKDAINPAGEAVLDVKVAEIPADFVTVASTDTCPFAIMANEEKRFYGVQFHPEVTHTKQGLRLLERFVGICGCE..................................... 205
4 -66.600[F] KOG1622 GMP synthase  ali follow..  21  27.AVVILDAGAQYGKVIDRRVRELFVQSEIFPLE---TPAFAIKEQGFRAIIISGGPNSVYAED-APWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVD--KVADGFKVVARS-GNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSKVLVLLSGGVDST 250
5 -51.400[J] KOG1224 Para-aminobenzoate (PABA) synthase ABZ1  ali follow..  35  83VRTLLIDNYDSYTFNIYQALSTIGVPPVVIRNDEWTWEEAYHYDVAFDNIVISPGPGSPMCPADIGICLRLLLECDIPILGVCLGHQALGYVHGAHVVHAPEPVHGRLSGIEHDGNILFSDIPSDFKVVRYHSLIIDKESLPKELVPIAWTIYDILMGIMHSSFPHYGLQFHPESIATTYGSQLFKNFKDITVNYWSRCKSTSLRRRNIND..................... 353
6 -30.900[E] COG0118 Glutamine amidotransferase  ali follow..  20  4.NVVIIDTGCANISSVKFAIERLGYAVTISRDPQ--------VVLAADKLFL-PGVGTASEAMKNLTLIELVKRVEKPLLGICLGMQLLGKVQCLGLVDGEVPHMGWNTVQVKEGHPLFNGIEPDAYFYFVHSFAMPVGD-----YTIAQCEYGQPFSAAIQAGNYYGVQFHPER-SSKAGARLIQNFLEL......................................... 203
7 -30.500[EF] COG0505 Carbamoylphosphate synthase small subunit  ali follow..  24  189YHVVAYDFG--VKTNILRMLASRGCRLTVVPAQT---SAEDVLALNPDGVFLSNGPGDPEPCTYAIKAVQKLIESGKPIFGICLGHQLISLAIGAKTLKMRFSHHGANHPVQDLDSG------KVVITSQNHGFAVDADTLPANARITHKSFDNTLQGIELTDKPVFCFQGHPEASPGPQDVGLFDKFIGNMKAAKR................................... 376
8 -30.400[F] KOG3179 Predicted glutamine synthetase  ali follow..  16  8KRFALFKTYGGYFNVFVSTFGEEGEQWDLFRVIDGQFPDENDLD-KYDGFVISGSPHDAFGDVKLCEVCQKLDHMKKKVLGICFGHQIITRVKGGKIGRALK-DMGLRSITIAKDNE-DVEVPASLAIIKCHQDEV--LELPESATLLASSEVCNVEMFSIGDH-FFCIQGHPE-----YNKEILFEIVD--RVLNMKLMEQEFADKAKSTMETAQPDRILWQKL....... 242
9 -29.200[E] COG1897 Homoserine trans-succinylase  ali follow..  16  36LKVLILNKKIETENQFLRLLSNSPLQVDIEHLNNFYCNFEDIQEQNFDGLIVTGAPLGLVEFNDVAQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTTDKLSGVYEHILHPHALLTRGFDDSFLAPHSRYADFPAALIYTDLEILAETEEGDAYLFASKDKRIAFVTGHPEASWRSHGNLLFTNWLNYYVYQITPYDLRHMNP.......................... 306
10 -26.900[R] COG2071 Predicted glutamine amidotransferases  ali follow..  24  30..............RYVDAIQKVGGFPIALP--IDDPSTAVQAISLVDGLLLTGGQDFPPRDSYEIALVRAALDAGKPIFAICRGMQLVNVALGGTLLQRVDEQLGSHTIDIEPTSELAKHHPNKKLVNSLHHQFIK--KLAPSFKVTARTADGMIEAVEGDNLPYLGVQWHPELMFQPESEQLFQALVDESKKTMV................................... 243
11 -25.500[H] KOG3210 Imidazoleglycerol-phosphate synthase subunit H-like  ali follow..  15  14KVIGVLALQGAFL-EHTNHLKRCLAENDYGIKIEIKTVKTPEDLAQCDALII-PGGES-QRTGLYPCLYEFVHNPEKVVWGTCAGLIFLSAQLGVLKVDVRRNAFGRQAQSFTQKCDFSNFIPDNFPATFIRAPVIERDPIAVKSLYELPVNGKDVVVAATQNHNILVTSFHPE--LADSDTRFHDWFIRQF........................................ 221
12 -25.500[H] COG0311 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis  ali follow..  14  1MKVGVIGDVSEHIDATNLALKKLGVSGEAIWLKKPE------QLKEVSAIIIPGGESTTIQKTGLFEPVKKLIEDGLPVMGTCAGLIMLSREVLGAVLDVRVNRNAYGRQVDSFEAPVRLSFDDEPFIGVFIRAPRIVELLSDRVKPLAWLEDRVVGV---EQDNIIGLEFHPEL---TDDTRVHEYFLKKA........................................ 195
13 -23.100[F] COG0047 Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain  ali follow..  17  1MKFAVIQFGSNCDLDMLHAIRDSLGEEAEYVWHAET------SLAGFDAVLLPGGTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEILPGALIRNNNLHFEGEIIQVPVAHGEGNYYCDDETLLKLKD---NNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVGTDGLRLFESVVKAWKEEQ.................................... 224
14 -15.000[E] KOG0623 Glutamine amidotransferase/cyclase  ali follow..  20  13..................................................LIFPGVGN--AKQGFLEPLRRYALSGKPFMAVCVGIQALFEVFPGLVQRFDNPHIGNSCAVRSDTSKEFFGMRPHDKFYFVHSYMIPEKGLPPEFKIATTKYGNETFVGAIVKNNFLATQFHPEK-SGSAGLRCLKAFLTGNYEQPISGEASKLIENSFGGLTKRI................ 203
15 -14.000[E] KOG4201 Anthranilate synthase component II  ali follow..  1...................................................................................MEGLVPVQRLPIKVASPSLYRCNNSVSIRRSISGFAMDRKINFRAPSQFSIRAQQSDLKESLAVSSSSVEDKGNVLRIKEWE--VEMYQEELAISQGIRIRRKPPSKAPLHNNDADSPRNILEEITWYKDVEVSRMKELNPLD...... 151
16 -12.300[F] COG0504 CTP synthase (UTP-ammonia lyase)  ali follow..  18  303....LPDAYLSVAEALRHAGYAFDADINIKWVDSEDVTNVAEQLQGVDGILVPGGFGDRGIEGKI-EAIRYAREQKIPFLGICLGMQLASIEFARNVDMGGTLRLGLYPCKLKNGTLAQSAYNDQVIYERHHRYEFNNQYREKGFMFSGTSPDGRLVIVELGDHPFFASQFHPEFVSRPTRQPLFREFIQASLRK..................................... 532
17 -11.400[S] COG4285 Uncharacterized conserved protein  ali follow..  11  1MNVLIYNGNGASKICLLRTFQSLLYAMRFVDASTLEKEP---WPASTALLVMPGGRDMGYCNETIYRKITDFVKRGGAYLGLCAGGYFGSAVVDFRMPDSDLNVVGKRKLQFFPGTCAMQSSPVHTHIYFNGGGSFLETENYSNVKVVARYQETAIIYVKVGKGNVVLTGIHPEFRDEKTRLELLSYILKLLGLKVPKDTSKCGQPTLTDQYNNVETKRFIEKALTNKVKNQ 281
18 -9.830[F] KOG2387 CTP synthase (UTP-ammonia lyase)  ali follow..  20  304VKIALVDSYLSVTKSLEHASMKCRRQLEILWVEASNLEPSWNKLSSADGILVPGGFGTRGIEGMI-LAAKWARESGVPFLGVCLGLQVAAIEFARNVIGRPNSSSGGTMRLGLRPTIFQPNSVNEVHERHRHRYEINPKIVNDGFIFVGKDETGQRCIFELKGHPYYGTQYHPEYTSKVEPSRPFWGLVAAAPAHLV................................... 563

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.