current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675949|ref|NP_273067.1| putative acetyltransferase (NMB0001) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MNSLFVDNTVFITRLKAGHIGRLVQALFEEWHGFEPWSSVDKIHAYYGRCLKDDELPLAFAAVDDSGILLGSAAVKRHDMESFPRYEYWLGDVFVLPEYRGKGIGRRLVAHCIGAARSLGIKFLYLYTPDVQIFYESFGWVVVGRHFHNGEWVTVMRLDVDKVLast
1 -36.200[E] COG1246 N-acetylglutamate synthase and related acetyltransferases  ali follow..  15  1....VMESAEQIRRATINDIGGILELIRPLEQQ---GILVRRSREQLEMEIDK------FTIIQRDNTTIACAALYPFPEEKIGE----MACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDQLYNYQRKSKVLMADLG.. 153
2 -32.200[R] COG3153 Predicted acetyltransferase  ali follow..  17  9.RIHPTRLLMLIRTEAPADILVVDQLLKNVFAT-------EAEADLVMALRENGQRTLSLVACDDEGEIVGHVMFSPVTLEGEDLNWQGLAPLAVKEEYRRQGIGAELVKEGLSSLGELGYPACVVLGDP--AYYSRFGFEDAARYAWDVPQGAFQVVALWE. 164
3 -31.400[M] KOG3396 Glucosamine-phosphate N-acetyltransferase  ali follow..  16  14.TDISVPTGLRLRALRNDDFGYLELLKQ----TSVGFINQLVFRKQFDAMKKAKSYYIVVLEHIESSKIIGAATLIEFKYIHEAGTRGRVEDVVVDEKMRGKKLGALLNEVLVEMAKTIGVYKLSLECTELIPFYNKFGYSKNLH.................. 156
4 -29.900[R] KOG4144 Arylalkylamine N-acetyltransferase  ali follow..  15  2.........VNIRNIERSEVEEVSKLEAICFPEAERA-SFARIKDRVKRAPEI----GLFAPTQHTSTLIGHVLTSRTGSETVTHES-AIHSLSIHPAHRKNGYAKKLIEELQFRCQHTITPKPSRMIKPLVPFYESLGFKNLGECKFGDETWYDMTHKI... 165
5 -29.400[E] KOG3216 Diamine acetyltransferase  ali follow..  18  3........SVRIRSVIKEDLPTVYQFIKELAEFEKCEDQVEATIPNLEVAFGEVTPVAYGVFIEENDQPAGMAIYFLNFSTWTSRVGIYLEDLYVRPQFRGKGYGSYLLSYLARESLRIGGRRLDWVVQRAIEVYEKAGAQKVGG.................. 146
6 -29.300[R] COG3818 Predicted acetyltransferase, GNAT superfamily  ali follow..  16  1.......MTSPIDRIAPGDEADILALNNEHAAELSWLEAERSFLLGEAFYARRIGDLEAFIMTFDQEANYDSPNFL---FCERYERFIYVDRVVVAAHARGRGHARRLYQDLFEHAERAGYMLVTCENPASDAFHAALGFTEVGDAVIHGKVVRYYVKQI... 160
7 -29.000[M] COG1247 Sortase and related acyltransferases  ali follow..  13  1.........MTLRLAEHRDLEAVVAIYNSTIASRMVTADTETPEDRMEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTAEV-SIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLMAHNKPSLKLFEKHGFAEWGLFPGIAEDLKILGRELS.. 163
8 -29.000[R] KOG3234 Acetyltransferase, (GNAT) family  ali follow..  15  2.........TTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPD--------YFHVAEGPGNRVMGYIMGKVEGQGESWH--GHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIKAYFVDLFVRPAIKMYEKLGYIIYRRYYSGEEDGLDMRKALSR. 152
9 -28.700[R] KOG3235 Subunit of the major N alpha-acetyltransferase  ali follow..  16  1.........MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPM--------LSYVATDPKGRVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAVEVYGAKYMSLHVRAAIHLYDTLQFDVQGKYYADGEDAYAMHKDFST. 154
10 -28.700[R] KOG2488 Acetyltransferase (GNAT) domain-containing protein  ali follow..  11  60.........KRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRA-WYLIAWENSSVPVAFSHFR---DVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLHNHGAYQFFEALQFEIDDGCCGEDCSYEILSRRTKF. 220
11 -28.300[R] KOG3139 N-acetyltransferase  ali follow..  16  228.YDQVRTVRNTYLIPRISNTQDIMRLIQAELSE-----SIYTYRYFIYN-------PKLCFLASHDNQYVG--AIVCKLDMHMNVRRGYIAMLAVRKEYRKLKIGTTLVTKAIEAMLADNADEVVLETEPALRLYENLGFVRDKRYYLNGVDALRLKLWFR.. 383
12 -27.100[R] COG3393 Predicted acetyltransferase  ali follow..  15  130..........GVQHLSVDDLNRLLVLHDQIDDFAQNDNGKEQMKVSMEKGASR------TYYVEEDGKIIASAST-----AAENSRSAMIVGVCTHPDYRNQGLASRCMSALCEDLLAEGKT-LFYDNPVAGRIYKRLGFKDIGRW................. 255
13 -27.000[R] COG0456 Acetyltransferases  ali follow..  13  130..YDKTPPFFELGPPEPGDTEAICELARDSFTKLSRDAANEIFQEWTRNNLNGRA--AVNIVAKHNGEVIGYLQGLSRDDECI------LDLMAVKPGFEGKRIAFHLLANLIEQPETQKHRTVTAGTQRAIRLYERMGFTAEQSYY................ 278
14 -26.100[S] COG3375 Uncharacterized conserved protein  ali follow..  11  1.....MEVVVRRLSD-PVELEEAVEVHARAWGSRDYREVVAPHILRALVDNGG-----LVLGAFVGGRMVGASYGWFV--GCGEGRYFYSHATGVEEGYKYRGVGFALKARQREEVLREGVSLAKWTSLNTRFNLAKLGAVYRV................... 136
15 -23.000[KR] COG0454 Histone acetyltransferase HPA2 and related acetyltransferases  ali follow..  15  1.........MAAKRVEAKDYKKAAATLVDAFFD-TNEQQFKKLMTEMFEYIVYAHIIRGLVLEVGDFAGISL-DTKADVLKERDDHSWYLVYVGVSSKEQGKGYLRKLIEPIFNICDQEGLP-IYLESSHLHNIYEHFGFVYQQSIY................ 190
16 -22.700[R] COG2153 Predicted acyltransferase  ali follow..  23  51............................................................ILGWKNDELVAYARILKSDDDLEPVV---IGRVIVSEALRGEKVGQQLMSKTLETCTHHPDKPVYLGAQALQNFYQSFGFIPVEVYEEDGIPHIGMAREVIQA 153
17 -21.700[C] COG3053 Citrate lyase synthetase  ali follow..  17  68...........................................................FITVTRDEKLIACGGIAGN-----------IKCVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKEYEALFRQCGFSTLTSVP................ 146
18 -21.300[R] COG3981 Predicted acetyltransferase  ali follow..  13  1.........MEIRRPTLKDKDAVLSMINETDGLWHFNVNDFNYETWLEDSLRQEM--IQYVAFDERSQAIGFLNLRLRLNERLLEKGGHIG-YSVRPSQRGKGYAKEMLKQAVSYAISKNITTILVTCDESRAVIVANVGILEDS.................. 153
19 -20.800[R] COG4552 Predicted acetyltransferase involved in intracellular survival and related acetyltransferases  ali follow..  15  2.........MAIIQLNESHYDEVLNLSSYAFQYPLTQSERQERAIILKEQ---------IYGIFYDEQLAAKLHIYPFQIWFNGQKIE-IAGVATYPEYRRQGFVKDLLLHSLREMRRNGQSVSILHPFSI-PFYRKYGWELFSY.................. 130
20 -19.600[R] COG5628 Predicted acetyltransferase  ali follow..  11  3.............................................................................NKVGTHYKIDWNMGEFFIIARFQNKGVGRQVAKQIWQMHKRLWEVAVIPENKPALNDFKAFPYTSLLS.................. 70
21 -18.800[R] KOG3138 Predicted N-acetyltransferase  ali follow..  14  623..SHPTRSTIDFCFVRPQHIPAVNALLQSTFWP--------DVSECLSY-------PDYSVVALYKKLVIGCGFLVPDVGYN----EAYISFMAVRPCWQRSGIASFMLYHLIQTCMSKD---ITLHTNAAVMLYQKFGFKMEELDSKQSRNAFFLRLQ.... 773
22 -18.400[G] KOG4135 Predicted phosphoglucosamine acetyltransferase  ali follow..  12  1MNTTVDCGNLILVPYQKCHVLKYHNWMKNEELQELTCSEPLTLDEEYQNMFLTEEYADGIEEFDDSPSDANATNATKES---EVHIVGELELMIAEPQNRRKGYGTKIVDAFLHYVKNKQILKYRVQNKPSIRLFKKLGFSQVKYNAYFDHVELELMRT.... 215
23 -13.900[TQ] COG3916 N-acyl-L-homoserine lactone synthetase  ali follow..  1....MIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDTPEAQVFGCWRILDTTGPYCSPHIWELSRFAINSGQKGSLCTLEAMRALARYSLQNDIQTLVVTTVGVEKMMIRAGLDV-PHLKIGIERAVALRIELNAK 183
24 -13.600[R] COG2388 Predicted acetyltransferase  ali follow..  17  15..............................................................LTDGGQIVGFAEYQDQGDTVV------LPHTEVSAGHEGEGLGSQLAQFALNDIRQAGKKVVPTCPFIRSYIEKHPEYADL.................... 89
25 -12.600[J] COG1670 Acetyltransferases, including N-acetylases of ribosomal proteins  ali follow..  16  61.............................TYLFQESVADMEELVSLLNQMLARKDRFYYAIIDKATGKALGTFSLMRIDQN---NRVIEVGAVTFSPELRGTRIGTEAQYLLACYVEELNYRRYEWKCDASRRAAERLGFI...................... 174
26 -12.500[I] KOG2779 N-myristoyl transferase  ali follow..  86............................................................VRAKTSKKLVAFISGVPARIRVRDEKMAEINFLCVHKKLRSKRLAPVMIKEVTRRVHLENIWQAAYTAGVI................................ 158
27 -11.400[I] COG5092 N-myristoyl transferase  ali follow..  100..............TNDNELSEVHELLTENYVEDATAMLRFAYISEFLRWALMPP--HVGVRVKSSRKLVAFISAVPLSIRVRDKKCAEVNFLCIHKKLRSKRLTPLLIKEVTRRCHLENVWQAVYTAGVL................................ 223
28 -11.300[R] COG1444 Predicted P-loop ATPase fused to an acetyltransferase  ali follow..  15  458FRQFFGIYVQAHYRNEPDDLGMLLDAPHHTARALALPNGKIVVSVELAYEGGLDDLSIDQAL-KLPGNIIPDRFLKYWRLPEFAKLRGWIVRIATHPELQDMGLGTLMLKKIEEEARELGMDYVFGVYDRLLKFWVRNGYVPIERNPSSGEYSVLLVKPLNEK 630
29 -10.200[Q] COG3882 Predicted enzyme involved in methoxymalonyl-ACP biosynthesis  ali follow..  12  445....KLEMILRWSVMKETHVQRVTQLSQRT--NQFNLTTERLTEQDVKQTMGESSREVIFTFGLTDR--FGDNGLVGYVHIEKSERLWVIRNFVMSCRVFKRQVESEVLRLLVEQAKAEGIHTIYRPTVKVSSFYEEHGFRLEGE.................. 587
30 -10.200[BK] KOG2535 RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase  ali follow..  15  445................................................................EQDILVGLLRLRDTFRPELKGECSIVRELHVY-KFQHQGFGMLLMEEAERIAREHGSTKLAVISGGTRNYYRKMGYQLDGPY---------MSKSIEE. 550
31 -10.000[L] KOG3014 Protein involved in establishing cohesion between sister chromatids during DNA replication  ali follow..  26  286.........................................................................................IRAIWVSPSNRRKGIATWLLDTTRLT................................................ 311
32 -9.120[O] COG2935 Putative arginyl-tRNA:protein arginylyltransferase  ali follow..  16  158............................................................INDKARGPLIATALTDRMSDG--------LSMVYSDPALSERSLGTYMILDHIRRAKERGLPHVYLWVKGSRKMGYKTKFLPQE................... 237

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.