current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675950|ref|NP_273068.1|(removed signalp:1-36) hypothetical protein (NMB0002) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst GDAEDNLLSIQSGYRALLQKQNNLDGKIIGMQSDLEDARRRLQTAQADIARLEAEIPAAMAQKARQAEDLRQIGVRLDHAWNAVYGAGGTKASGNLast
1 -9.080[S] COG3883 Uncharacterized protein conserved in bacteria  ali follow..  12  30...NTDIQNQDKKINDIKSKKTGLQSDLSSLVADLEKAQEKAKSLQGEFDQTGKELKQLNQDIKDINERIKERETVLKERARAMQKTSNS..... 116
2 -6.980[M] COG4238 Murein lipoprotein  ali follow..  22  22......................SSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKD-------DAARANQRLD................. 70
3 -5.870[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  10  853..LLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPV........... 934
4 -5.830[R] COG4768 Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain  ali follow..  11  27...........................LKSTSQTMDEVAKSLEKITVEVQGITGQSQKLLDKTNTLLEDVNGKVAKVDPVFDAVGDIGTS..... 89
5 -5.770[MU] COG1538 Outer membrane protein  ali follow..  18  272......................GLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTGTGSAELGGLFKSGTGVWSFIFTWGTNKAN.. 352
6 -5.730[S] COG4275 Uncharacterized conserved protein  ali follow..  10  61..........ECTFDTMVKEFGLSFPALEHVARIVRGADTDRRELEPEAAGLLAVSLGLSRMYADDLEQLEAGMTIYDALYRWA........... 134
7 -5.550[S] COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain  ali follow..  11  152...SAERAQLNEQKDSLLAESSELQSQVKLRDQELSKRQERIAQQEKVLARQREQVQSLEKRFASLEAQRQQLQAEINQ................ 227
8 -5.460[Z] KOG1003 Actin filament-coating protein tropomyosin  ali follow..  21  39..LEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEA............... 116
9 -5.410[D] COG4942 Membrane-bound metallopeptidase  ali follow..  16  51..IQADIAAKERAVRQKQQQRASLLAQLKKQEEAISEATRKLRETQNTLNQLNKQIDEMNASIAKLEQQKAAQERSLAAQLDAAFRQG....... 136
10 -5.390[I] KOG1511 Mevalonate kinase MVK/ERG12  ali follow..  15  236..QPKSTKKLVQGVFELKERLPTVIDSIIDAIDGISKSAVLALTSESDKNSSAKKLGEFIVLNQKLLECLGVSHYSIDRVLQATKSIGWTKLTG. 327

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.