current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675953|ref|NP_273071.1| arsenate reductase (NMB0005) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MPEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELKDIFNKLGLASARGMMRVKDDLYKELGLDNPNLDNDALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVLLast
1 -57.200[P] COG1393 Arsenate reductase and related proteins, glutaredoxin family  ali follow..  24  2...IKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDILTKTD-NGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQVGYKEDDIRAFL 114
2 -17.100[O] COG4545 Glutaredoxin-related protein  ali follow..  17  1MSKPILFYAETCPDTAPFVAELDRLGVDYDEVEIMTSLPNLKQFIRL...................................................................... 47
3 -14.300[O] COG0695 Glutaredoxin and related proteins  ali follow..  16  1MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIK--------------RSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDP....................... 80
4 -10.000[O] KOG1752 Glutaredoxin and related proteins  ali follow..  13  54.NCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIF-----------VNGTFIGGATDTHRLHKEGKLLP....................... 135
5 -9.470[O] COG0278 Glutaredoxin-related protein  ali follow..  15  14.NPILIYKFPSCGFSARAVEALMHCKVPFGYVDILQH----PDIRAELPAYANWPTFPQLWVDGELVGGCDIILEMFQQGELQTLLADVAAKYPQ...................... 108
6 -9.000[O] COG0625 Glutathione S-transferase  ali follow..  15  1MSMITLWGRNNSTNVKKVLLTLEELELPYEQILA---------------------------------------GREFGINHDADFLAMNPN--LVPLLRDDESDLILWESNAIVRYL 77
7 -8.780[O] COG2999 Glutaredoxin 2  ali follow..  12  1...MKLYIYDHCPFCVKARMIFGLKNIPVELNVL-----QNDDEATPTRMIGQKMVPILQKDDSRYLPE------SMDIVHYVDNLDGKPLLTGK...................... 81
8 -8.170[O] KOG0911 Glutaredoxin-related protein  ali follow..  11  401.SEVMLFDEPKCGFSSKVVKALRGENVSFGSFDILTDEEVRQGIKNF--------------SNWPTFPQLYYKGELIGGCDIIMELSESGDLKA....................... 484
9 -7.900[R] COG3019 Predicted metal-binding protein  ali follow..  10  26.LSMEVWKSPTCGCCNEWISYMQKNGFEIKVNETGNYDAHKRF-----------NIKYEHASCHTAVIDGYVIEGHVPAEDIKRLLAEKPDALSAPGMPIGS............... 117
10 -7.580[S] KOG4420 Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1)  ali follow..  45.ESLVLYHWTQSFSSQKVRLVIAEKGLVCEERDV-----------SLPQSEHKEPWFMRLNLGEEV-----------------------PVIIHRDNIISDYDQIIDYVERTFTG.. 124

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.