current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675954|ref|NP_273072.1|(removed signalp:1-22) thioredoxin-related protein (NMB0006) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst DELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGIALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTVGVLPFTVVEAPKCGYRQTITGEVNEKSLTDAVKLAHSKCRLast
1 -36.700[R] COG3054 Predicted transcriptional regulator  ali follow..  11  41TLNKDEFSYKNWNSAQLAGKVRVLLHIAGRTSAKEKNATLIEAIKSAKLPHDYQTTTIVNTDDAIVRSSIESNKKLYPFIVDSNGVARNAWQL----KEEGSAVIVLDKDGRVQWVKDGALTQQEVQQVVDLLHK... 181
2 -34.000[O] COG1225 Peroxiredoxin  ali follow..  16  11DFSAPATSGLTFSLAGQRGKVVVLYFYPKDNTPCTTEAMNFRDQYDAFEAADAVVFGISRDSLKSHENFKAKLELPFELLSDADEAVCALFDTIKMKRGIERSTFLIDRKGVLRQEWRGVKVPNHVDEVLGAVRA... 153
3 -31.300[R] KOG2501 Thioredoxin, nucleoredoxin and related proteins  ali follow..  15  2.....STNVMQVLVSKLVGKTIGLYFGAHWCPPFRSFTSQLVDVYNELATTDFEVILISTDRDSREFN-INMTNMPWLAIPYEDRTRQDLCRIFN--VKLIPALVIIGPEEKTVTT...................... 112
4 -30.200[O] KOG0855 Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes  ali follow..  14  71DLSLLNEDNDSISLKKITENVVVFFVYPRASTPCTRQACGFRDNYQELKKYA-AVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAE 210
5 -27.700[O] KOG0910 Thioredoxin-like protein  ali follow..  21  94.................SAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDK-LTIVKIDHDANPKLIA----------------------------KVYGLP-HFILFKDGKEVPRREGAITKAKLKEYIDGLLNS.. 186
6 -26.300[O] KOG1651 Glutathione peroxidase  ali follow..  12  14QFTVKDSSGKDLNMSIYQGKVLLIVNVASKCGFTETNYTQLTELYRKYKDQDFEILAFPCNQSQEAHEFACRFKAEYPVFQKVRVNGQNAAPIYKFLKASKPTKFLVGKDGLVIDRYGTMVTPLSIEVSVLYISKVP. 170
7 -25.900[O] COG0450 Peroxiredoxin  ali follow..  11  10PFTAQAYKDVTVSEADVKGKWSVFFFYADFTFVCPTELEDLADNYDVFTRLGVEIYAVSTDTHFSHKAWHDSSKIKYTMVGDPSGQVTNNFEIMRPGVGADRGTFLVDPQGVIQFMEVTAEGIGRNAIELLRKIKAAQ 156
8 -25.900[O] KOG0852 Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes  ali follow..  13  58QFEGTAVVNVKLSLSQYLGKYVVLLFYLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPDVKIPLLSDLTHKISKDYGVYLESSGALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQ 207
9 -24.800[O] COG2077 Peroxiredoxin  ali follow..  12  26DFTTVSAKLEDTTLANFAGKRKILNIFPS-TGICATSVRKFNEQAAKL--ANTAVLCLSTDLPFAQARFCGAEGLENVFTVSTFRN-KDVHKQLGVDIVEGPAVIVLDENNRVLHSELEIKQEPNYDAALAVL..... 165
10 -24.800[O] KOG0907 Thioredoxin  ali follow..  19  206.................GGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSET-VVFARMNGDENDSCMEFLKDMNVI-----------------------EVP-TFLFIRDGEIRGRYVGSGKGELIGEILRYSGVR.. 299
11 -24.500[S] COG4312 Uncharacterized protein conserved in bacteria  ali follow..  48RYVFDTASGKKTLADLFDGRSQLMIYHAAGCPGCSLVADHLGGTLAHLNHHDVTLIAVSRAPLPEIEAYRQRMGWQFPWASSFGTTFNHDFSAQANDELPGLSAFYKDEAGNVYHTYSTYARGLEDLIGTFLILD... 211
12 -24.300[S] KOG4498 Uncharacterized conserved protein  ali follow..  14  73TVKVLDLRGNEIPISDWKDRKAVVAFARHGCVLCRKRAAYLAEKKDVMDASGVALVLIGPGSIDQANTFVEQTKFKGEVYADPNHASYEALETVERGGWQQGGILVAGPGKDNIS....................... 225
13 -24.300[O] COG0386 Glutathione peroxidase  ali follow..  14  5DFQMKDAEGNAVDLSGYRGKVLLIVNTATRCG--TPQYEALQKLYAQYTAEGLEILDFPCNQSGEIAQVCMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPTKFLVNRDGEVVERFAPSVTPEEIEADIRALL.... 177
14 -22.400[O] KOG0908 Thioredoxin-like protein  ali follow..  15  5..VINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPK--AIFLKVDVDKCQDTAA----------------------------GVSAMP-TFIFYRNRTKIDRVQGA-DVNGLEAKIQEHIGTSG 110
15 -22.400[AD] KOG3414 Component of the U4/U6.U5 snRNP/mitosis protein DIM1  ali follow..  10  7..HLHSGWAVDQSILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNF-AVIYLVDITEVPDFNTMYE--------------------------LYDPS-TVMFFFRNKHIMIDLGTGNNNKINWALKDKQE... 111
16 -22.400[O] COG2143 Thioredoxin-related protein  ali follow..  68.........SDNKSISPNDKYMLLVFGRNGCSYCERFKKDLVKELRDYIKEHFSAYYVNISYSKEHDFKVGDKNNE-----EIKMSTEELAQIYA--VQSTPTIVLSDKTGKTIYELPGYMPSTQFLAVLEFIGDGK. 191
17 -21.900[O] COG3118 Thioredoxin domain-containing protein  ali follow..  14  8.FDVTGANFEQLVIENSFHKPVLVDFWADWCAPCKALMPLLAQIAESYQGE-LLLAKVNCDVEQDIVMRFG--------------------------IRSLPTVVLF-KDGQPVDGFAGAQPESQIRALLEPHVKAP. 115
18 -21.700[O] KOG4614 Inner membrane protein required for assembly of the F0 sector of ATP synthase  ali follow..  12  118HLIGTAMDGTKQQNIELRGKTSIVRLFSSYFQGIVDDNKKTDYLTEADNDSNVQIIEVNLVENARWANRVPSWRQPFYFECSRGQWPFSVREELFCNNVFSGYVFLVDQQLKIRWAACGEATPSEKEALWKFAKR... 278
19 -20.600[R] COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems  ali follow..  14  62DFTLTDGEGKPFNLSDLKGKVVILSFGFTHCPDCPTELLTYSDTLKQLGGQAVKVVFVSIDPERDTPEIIGKYAKQFPDFIGLTATGGQNLPVIKQQYRVV-GAYLIDKNGEVAIFSPYGSEPETIAADVRTLL.... 217
20 -20.000[S] KOG2640 Thioredoxin  ali follow..  175..ILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNSLPRAF--PALHFLALDASQHSSLST----------------------------GTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTG... 279
21 -18.800[S] KOG3425 Uncharacterized conserved protein  ali follow..  3.........NLIKLYENQRSPIYIYFYGEWCPDCVAAEETIMSAFRNHAPADCMILVVDVGSRESWI------------------GKDNMFRKPPYSVEGIPTLIRWKGVERLDGDQL--LKSSLLELFFEE...... 112
22 -17.400[O] COG0678 Peroxiredoxin  ali follow..  28.......RWEDKTSDDFRGKRIILFSLGAFTPTCTLQLPDFEMLYDEFEKEGIAIYCVSVNDAFVMNAWGKALGQKVQLIPDGSGEFTRKMDNLGFGMRSWRYAAVIN-NGVVEQWFEDPYGVSSPQNVLETLRA... 175
23 -17.100[O] KOG0541 Alkyl hydroperoxide reductase/peroxiredoxin  ali follow..  12  12DGTISFFQLQTVSVHSAAGKKVILFGVGAFTPTCSMSVPGFIGKAEELKSKGIEIICFSVNDPFVMKAWGKTYPENVKFVADGSGEYTHLLKDKGLGIRSRRFALLLD-NLKVTVANVGEFTVSSAEDILKAL..... 162
24 -16.600[OC] COG0526 Thiol-disulfide isomerase and thioredoxins  ali follow..  12  21SAEVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKDGISLVEVDCTEEGDLCSEYS--------------------------IRGYP-TLNVFKNGKQISQYSGPRKHDALVKYMRKQLLPT. 130
25 -16.600[OC] COG4232 Thiol:disulfide interchange protein  ali follow..  15  452..QIKTVDELNQALVEAKGKPVMLDLYADWCVACKEEKYTFSDPQVQKALADTVLLQANVANDAQDVALLKHLNVL-----------------------GLPTILFFDGQGQEHPRVTGFMDAETFSAHLRDRQP... 565
26 -16.200[C] KOG2792 Putative cytochrome C oxidase assembly protein  ali follow..  285PFTLVSTENKIVTENDFCGKWVLLYFGYSFSPDGPEQLPLTFGCLYLYAEFDSRILGLT-GTASAMRQMAQEYRVYFKKVQEDGEDYLVDTSH---------NMYLINPKMEIVRCFGVEYNPDELSQELLKEVASVS 428
27 -15.900[R] KOG4277 Uncharacterized conserved protein, contains thioredoxin domain  ali follow..  12  27PTAVLDLSDKFLDVKD--EGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKLDCTRF-PAVANKLSIQYP-------------------------TILFFRNGHVID-YRGGREKEALVSFAKRCAAP.. 134
28 -15.500[O] KOG0191 Thioredoxin/protein disulfide isomerase  ali follow..  18  38.................SKKGALIEFYATWCGHCKSLAPVYEELGALFEDNDVLIGKIDADTHSDVAD----------------------------HITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGI.. 131
29 -14.200[OC] KOG1672 ATP binding protein  ali follow..  67..EYREVSEGDFLGEVTRSEKVICHFYHKEFYRCKIMDKHLKTLAPRH--VDTKFIKVDAENAPFFVTKLA--------------------------IKTLP-CVVLFSKGVAMDRLVGFQDLGTKDDFTTNKLEN.. 171
30 -13.700[S] COG4243 Predicted membrane protein  ali follow..  16  223.......GEAEIALAQHLVKVGAKEYVAYWCPHCHDQKLLFGKEAYQIISD-NIKVECAEDSPKGQPELCRAAKIQFP-------------------------TWIINGQ-----TYSGVQNLSELAKITGYTGPSN. 322
31 -13.600[O] KOG0190 Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit)  ali follow..  16  448.................ESKDVLLEIYAPWCGHCQSFEPIYNKLGKYLKGIDSLVVAKMDGTSNEHPRA---------------------------KADGFPTILFFPGGNKSFDAVDVDRTVVELYKFLKKHASIP. 542
32 -11.000[O] KOG0911 Glutaredoxin-related protein  ali follow..  13  1......MSGTVKDIVS-SGAPVVLHFWASWCDASKQMDQVFSHLATDFPR--AHFFRVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTL................................................ 90

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.