current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675955|ref|NP_273073.1| ABC transporter ATP-binding protein (NMB0007) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MIRFEQVSKTYPGGFEALKNVSFQINKGEMIFIAGHSGSGKSTILKLISGITKPSRGKILFNGQDLGTLSDNQIGFMRQHIGIVFQDHKILYDRNVLQNVILPLRIIGYPPRKAEERARIAIEKVGLKGRELDDPVTLSGGEQQRLCIARAVVHQPGLLIADEPSANLDRAYALDIMELFKTFHEAGTTVIVAAHDETLMADYGHRILRLSKGRLALast
1 -98.100[D] COG2884 Predicted ATPase involved in cell division  ali follow..  41  1MITLDHVSKKYKSLRPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIPRLRQVIGCVFQDFRLLQQKTVYENVAFALEVIGRRSDAINQVVPDVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLV 217
2 -92.600[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  35  6SVEVHRLRKSVGQGLSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQLRAQVGFVFQSFMLIPTLNALENVELPALLRGENSGQSKAGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNREGTTLILVTHDPALAA-RCDRRLRLVNGQLQ 225
3 -91.000[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  35  4MLEVKHINKTYKGQYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLAHFRRKLGFVFQDFNLLDTLTIGENIMLPLTLEKEAPSVMEEKLHGIAAKLGIENLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRDHVTALMVTHDPVSAS-YCRRVIFIKDVVLF 222
4 -90.000[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  30  1MINVQNVSKTFILHLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIEWVDLVTAPARKVVEIRKTVGWVSQFLRVIPRISALEVVMQPLLDTGVPREACAAKAARLLTRLNVPERLWHLPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREAKTRGAAIVGIFHDEAVRNDVADRLHPMGAS... 225
5 -82.000[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  30  24VLAVKGLVKAYKSQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINDTQNIAALTTKQMRKWRAKCGMIFQDFCLVPRLDVITNVLLGRLFFKLFSEQDQARAIELLQWLNMLPHALQRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISENDIAVIVNLHSVDLVKDYCTRVIGIAHGRII 252
6 -80.700[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  33  1MINFKNVSKHF-GKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNSPNIDE-RQIRLEAGMVFQQFYLFPHLTALENVAFPTKVRGTSKEEAKKQALALLSKVGLEDRAHHYPAELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEEGMTMVIVTHEVGFAQKVASRLIFIDKGRIA 215
7 -80.300[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  29  3.IQLNGINCFY-GAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLEAPCRVLGLSKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIV 220
8 -78.000[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  33  1MIEIKSVNKVFYQGIHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLCAARRNIGMIFQHFNLLSSRTVFENVALPLELAGQSQQHIETKVTELLALVGLSEKRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRQNLTILLITHEMDVVKSICHEVAIIGGGELV 220
9 -77.900[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  36  5KLNVIDLHKRY-GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVDKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEPIQVLGLSKQEARERAVKYLAKVGIDERAGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKIE 231
10 -71.800[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  27  6AIEVKGLTKSF-GSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELYEIRTLFGVLFQDGALFGSMNLYDNTAFPLREHTKKESEIRDIVMEKLQLVGLGGDEKKFPGEISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQDATILIVTHNVNIARTVPDNMGMLFRKHLV 222
11 -71.700[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  27  1MLKLTDITWLYH---HLPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPS-----RRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNAVQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQQKMTLLMVSHSVEDAARIATRSVVVADGRIA 209
12 -69.900[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  26  1MIRLQDIQVTFNPGNRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQR---ANLCARVFQDAGTCGALTIEENMALAYMRGKKRSNQRRKLFQERISILGLEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKENLTVMMVTHSMKDALACGDRTVMLHQGQIV 228
13 -68.300[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  33  1MLNVSGLWAEYQ-GKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVSGPSAER--------GVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIRDTGKQILLITHDIEEAVFLASELLLLS..... 203
14 -67.900[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  27  24AMATEDLHVYY-GDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDEIEGQILYDGININR-KEVDLYNVRKEIGMVFQKPNPFTK-SIYENVAFGLKRHGMNKKEIMERVEKSLRRAALWDEVGKSALSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKN-KYTIIIVTHNMQQAARVSDYTSFFYLGEVV 245
15 -67.800[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  26  7LLQLQNVGYLA-GDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEI---YRQQVSYCAQTPTLFGD-TVYDNLIFPWQIRN--RQPDPAIFLDFLERFALPDSLTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVRENIAVLWVTHDKDEIN-HADKVITLQPHAG. 215
16 -67.700[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  32  1MIELDKLSKTFTQKFRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVT---LRRHIGYVIQQIGLFPNMTIEENIMVVPRLLGWDKARCKEKARELMSMVKLEPKLQRYPRELSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRKGMTVIMVSHDIDEAIKLGDKVAVFKSGRLL 220
17 -66.800[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  29  1MLCVKNVSLRL-PESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGAQFSCTGELWLNEQRIDILPTA-----QRQIGILFQDALLFDQFSVGQNLLLALPAT-LKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRAAIPVVQVTHDLQDVPADSSVL......... 204
18 -66.700[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  28  17AIELKDVQISFRLAFDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQG---------NRKAGYLFQQDALMPWKTVLENVAIGLEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLSQDKKAVMFVTHDLEEAIALADRVVIMSAG... 226
19 -66.600[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  30  4VVHFKNVNKYY-GGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLPPN-----RRNVNIVFQDYALFPHLNVGRNIAFGLELKGLSSDAIHKRTMELLALVKLQDFADRMPDQLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRTGKTFIFVTHDQEEALTMSDVIVVMNKGRI. 213
20 -66.300[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  29  29.LSKEQILEKT-GLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKQRTIVFISHDLDEAMRIGDRIAIMQNGEVV 244
21 -66.200[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  26  1MLEARELLCER-DERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVRDS----YHQNLLWIGHQPGIKTRLTALENLHFYHRDGD------TAQCLEALAQAGLAGFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISLTQTRAA 205
22 -65.600[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  27  3.IEIANIKKSF-GRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHAR-----DRKVGFVFQHYALFRHMTVFDNIAFGLTVLRPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEEKFTSVFVTHDQEEATEVADRVVVMSQGNI. 215
23 -63.600[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  27  6.LKITDLYKSY-GSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ-----RDIAMVFQSYALYPNMTVAGNIAFGMEIRKVPKPERDKAIQQVADMLQIGHLLDRKPSQLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSRKTTIVYVTHDQIEAMTLATKIAVLKDGVL. 214
24 -63.200[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  24  1MITLTDCSRRFQDKVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTVK----QPAEVKQRIGVLFGETGLYDRMTAKENLQYFGRLYGLNRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVI 216
25 -62.000[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  30  4ILSISGVSKTYATGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIGK----DYRAARSLIGLVPQELTIDAFESVWATVNYSRGLFGKPPNH--GFVEKVLRDLSLWDKKDAKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLREDGVTIILTTHYIEEAEAMADRVGVINRGEII 213
26 -61.900[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  26  3ILTAENLAKSY-KSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHNRA--QRGIGYLPQEASIFRRLTVYENLMAVLEIKDLTPQQRREKADELIEEFNISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRNRGLGVLITDHNVRETLDVCERAYIVGAGKII 216
27 -61.100[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  20  1MLEIRNLHARIDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGREEVTEGDILYNGQSILEMDPAERA--TSGIFLAFQYPMEIPGVATMEFLKVAMNEQRKARPEFLKRVKEAAASLNMDMAMLKRPVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRAPDRAFLVITHYQRLLEHIPDSVHVLYRGQVI 227
28 -60.600[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  33  5MLEIRNLSRCFPIHVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAGA--HSRAHGKKVQMVFQN-SLNPRRTVGQSVAVPLDAHGFPSLQRAKRISELLEMVQLANFAERFPHELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRRDLTYLFISHDLSLMRNFASRVGILYRGKLV 231
29 -60.100[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  28  5LLQVHELSKSYGG-IKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLAEMRTEWGFVQQN-GLRMRVSAGANIGERLLDIGRHYGNIRDEAAHWLREVEIPTRIDDLPAQFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRNHLSVIIVTHDIGVVRLLAHRLLVMQQGQVV 230
30 -59.300[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  24  16...................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKGCLTPEKRRVGYVFQDARLFPHYKVRGNLRYGM------AKSMVDQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTRENIPMLYVSHSLDEILHLADRVMVLENGQVK 208
31 -59.300[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  28  5LLEVRNLSKTFRYRVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPL---HFGDYSFRSQRIRMIFQD-SLNPRQRISQILDFPLRLNTLEPEQRRKQIIETMRMVGLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKGISYIYVTQHIGMMKHISDQVLVMHQGEVV 230
32 -59.300[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  30  5LLEVKNLTKSFDINVRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSEGDMRKRRRDMQIIFQD-SLNPRHTIEKIIREPLIVHQITKKEQLERVEELLETVGLSDHATRYPHQFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKETALTYIFIAHDLSVVKHISDRVAVMYLGRMV 235
33 -59.200[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  23  1MLTIDHVTKTF-GDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVNY-------HISNKIGYLPEERGLYPKMKVRDQLVYLARLKGMEKREAVKELGTWLERFNITDYENKKVEELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNSGVSILFSSHRMEHVEELCENLCILQKGKPV 208
34 -58.200[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  29  1MLKLASISKRF-GGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQIT--QMGIARTFQNIRIFKEMTLLENVVVGMHRYRAAERRARDRALELLSWVKLDHKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIRARGYTIFMIEHDMRFVMGLCERIAVLNFGRII 228
35 -55.700[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  24  1MIEINDVNKKYQ-QTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLA---TILSVLRQENHFTSRLTVSDLVGFGRYSRGRLNKNDRQHIDAAMEFLNLMPLKDRYLDELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADEHKTIILVIHDINFASAYSDHIIAMKNGEVI 215
36 -55.100[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  24  5ILKVENLTVYQ-GNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPITKLGN-----LRHLLGYMPQNFIF--PISVEELVGLGLSKLRIQSREKSAAIATALKRTDTYHLRNQAIGTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQQGWTVLQVSHDIDMVSRHCDRVLCLNQTVVC 229
37 -54.700[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  17  13AIRVSGMQFAYEVEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAGK-VGGKNVVQVLSRSAFHDTQLVCSGLSYLGGSWSKTVGSAGEVPLQGDFSAEHMIFGVEGTD-PVRREKLIDLLDI--NLQWRMHKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQGATIVYATHIFDGLETWATHLAYIQDGELN 228
38 -54.500[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  24  21.TLQHFWQRRYR-QILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFDPFR----RQTAFLRRTSLVMQKQQLIWDLPTLDSLRINGAIYEIPDQVFEQRLGELSEMLDLTTELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRRQATVLLTSHYMADITTLCERVLLIHQGQLM 232
39 -54.000[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  20  412VLESFGVRQRV-VERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIPS--------ELEPQITEKSILEQIFDITG-----DIHLAVEVLNRAGISDAVRARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREKITLIAVTHRKEVINALPDRILYVGYGGVT 617
40 -53.800[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  30  7SIRVTDLSYSVA-GRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTGELGK--SGVELFGQPLRDIKPAEAA---KRRAVLPQQTPLSFAYEVLDVVLLGRIHGQRETVQDRAIAAACLERVGLSGYETRDVLTLSGGEQQRVHFARTLAQGERVLLLDEPTASLDLAHQHATLRLARELCREGVGVLAVLHDLNLAAQYADRVLMLAEGHVI 222
41 -53.500[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  28  4LLDVKDLRVEFSTQVTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNTGSAKFEGKEILNLPERELNKVREQIAMIFQD-SLNPYMKVSDQLMEVLMLKGMGKAEAFEESVRMLEAVKIRKRITMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKRENTAIIMITHDLGVVAGSCDKVLVMYAGRTM 233
42 -53.400[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  25  5AISTETLSLGY-GDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVA---KELAILPQGPSAPEGLTVHQLVKQGQNWLKQWSKEDEEAVERALKATKLEDMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEKDRTIVMVLHDLNLACRYAHHLVAIKDKRIY 221
43 -53.100[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  30  1MLSFDKVSTYY-GKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTI--MRKSIAVVPEGRRVFSRLTVEENLAMGGFFT--DKDDYQVQMDKVLELF-LKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNANQALKLADRAYVLENGRIV 212
44 -52.300[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  25  3LLDIRNLTIEFMTSVKAVDRISMTLTEGEVRGLVGESGSGKSLICGVSKDNWRITADRFRFNDIDLLQLTPRQRRKVIHNISMIFQE-CLDPSESIGLQLIQAIPGWWQRFHWRKRRAIELLHRVGIKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNTTILLISHDLQMMSKWATRVNVLYCGQTV 238
45 -52.000[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  23  4VMQLQDVAES-----TRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGM-TSGKGSIQFAGQPLEAWSATKLA---LHRAYLSQQQTPPFATPVWHYLTL-----HQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKML 212
46 -50.700[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  27  5ILEIQDLTVSF-DGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRIA--RLGVGRKFQTPRVYLNLTVAENLDLAVNLMGQATGAEQRSVGGLLETIGLTPKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAE-SHSIIVIEHDMEFVRQIARKVTVLHQGSVL 224
47 -50.500[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  28  314ILEVKDLSMHFG-EMKALDGVSIKLLPGETLGIVGESGSGKTTMGRSIMRLYDPTAGEMLYRRADLSKIEGKELKAARRELRMVFQD-SLNPRMTVAQVIGEPLLVNGAKGKELEERVCSLMEQVGLPSGRERYPHAFSGGQRQRIGIARAITLRPRIIVADEATSALDVSVRFQVLDLLMKLQDEGLAYIFISHDIGVIRYMCDRVGVMYRGKLV 538
48 -50.500[R] COG3910 Predicted ATPase  ali follow..  19  1MLFLDSVAEEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVA-YPKIRMFLRAEDVLGYIRRQNENALDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGF-LDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGIT 232
49 -50.100[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  28  299..............LRAVDDISIRLQRNQTIGIVGESGSGKSTLGRALLRL-LPSDGLIRFGDRDISTADRQAMRPLRRQMQLVFQD-SLSPRMTVGQVITEGLLVPNLSGKQRDQRAVEALREVGLPNARNRYPHEFSGGQRQRIAIARAMILKPKMVVLDEPTSALDRSVQKQIVELLRKLQADELSYLFISHDLSVVRAMADYIIVMKQGKIV 505
50 -49.800[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  19  7SLQILQGTFRLS-DTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQL---QKLVSDEWQRNNTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQFGITPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLA 218
51 -46.200[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  24  5AIELIGINKSFG-AVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASIKTPND--AIALGIGMVHQHFMLVDNFSVLENIILGAESDASSIAKARSELERLEREYGLEVDPDAIIEELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKEQGKTVVLITHKLREIMAITDNVSVMRQGTMV 220
52 -44.500[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  26  477.VELKNITFGYRLEAPLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEIS---LQLLTNSVAMVEQEILLFGG-TVRDNLTLWDTTVPDKNLMRACQDAAIADVIGYDAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQ---NLRRRGCTCIIVAHRLSTIRD-CDQIIVLERGKVV 689
53 -44.300[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  19  69AIQIINLPKDLAKDTGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNTPPDWEEILTHFRGSELQSYIRVVEENTAIKPQHVDYIKEVVRGNLGMLEKLDERGLMEEICADMELNQVLEREARQVSGGELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRHDSYVIVVEHDLSVLDYLSDFVCCLYGKPGA 295
54 -43.600[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  21  323.LELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPV---SGEQPEDYRKLFSAVFTDVWLFDQ-LLGPEGKPA----------NPQLVEKWLAQLKMAHKLEIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQLLPLMQEMGKTIFAISHDDHYF-IHADRLLEMRNGQLS 528
55 -43.400[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  26  335MVSFNSFSKQYG-DGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEV----------------KISYKPQYIKADTPVSVQDFLRGIT-----KRFGTSYYEVEIANPLQLERIYESLLTELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAENQKTAMVVDHDIYMIDMLSQRLLVFEGKPSV 529
56 -43.000[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  24  7LIELRVDKYTYPNGRVGLSDFYATFEGCDF--IIGPTGSGKSTVLKMVNGLIPNFEGKVRVFGEKPN----------PRIAFFVKQN-EMITSTQVIDELVFPLIQQGFGWGEAKREAEEVCEELGIGGLLERKTYELSTGELQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKILRDY-----PHLVSEHRLEFSSFFEKTINLGLECEDF 211
57 -42.000[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  26  336.LRVENVTIVPPERKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETL---GRHIGYLPQGVELFDG-TIGENISRFDDNPDPEAIIAAARAAGAHELIGYDSDIGEAGSTLSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKARGGIAVVVAHRPSAIGA-VDYILMMEDGRMK 551
58 -41.600[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  26  350.IIANDLVVLSPQGKRLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGF-MPYQGSLTINGIELRELD---HAQWRQTISWVGQNPLLLYG-TIRDNVTLGIADEQVTQTLQAAYAQEFVEQQGLDYPISDRSAGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQ-QRTALFVTHQLQPLQS-VEQILVMENGLLV 560
59 -41.400[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  25  228VIEVEELQLK-----KGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRLSGPDD--ALMRGIGLLPESRKLITSFSILQNISLNNY---LDLKKELEHTTKAMAQVQVKQGPYARVDTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAARGHSIIMISSELPEVIGMSDRVCVFRSGGIV 446
60 -41.000[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  29  339.LTLRDVQFTYPESQQALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAAL---RQTISVVPQRVHLFSA-TLRDNLLLASSDEALSEILRRVGLEKLLEDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMR-EKTVLMVTHRLRGLSR-FQQIIVMDNGQII 551
61 -40.200[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  22  505.ISLRAVPVVTPNCDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELHIPRPV----------KDVPCMFYIPQR--YMSIGSLCDQIIYPDTREDMKRHITENELRSILKMVSLEDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM---GITLLTITHRPTLWKYHTHILEFDGLGN.. 712
62 -39.400[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  28  363.ISFKDVHFAYDPQRPILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVT---QESLRKFIGMVPQDTVLFND-TIAYNIRYGRTDASEEDVEKAAELAQIAGFIGYKSMVGERGLKLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSR-GRTTLVIAHRLSTVIG-ADEIIVLKDGLIA 576
63 -39.400[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  27  385VIMVQNVNFRYNDETPWIKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNS--------------HLRIARYHQH---LHELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGLTGRQQVCPRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDFDG---GMVLVSHDFRLINQVAEEIWVCEKETV. 581
64 -39.000[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  26  342.IEFRHVTFYYPGDTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYR---LGALRNQVALVSQNVHLFND-TVANNIAY-----ARNEQYSRAEIEEAARMAYAMDFINKMEHMLSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQK-NRTSLVIAHRLSTIEK-ADEIVVIEDGRIV 557
65 -38.800[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  20  6EIVNTDFSLAYG-SRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQLDGFPDK------------------TLRTCFVEHKLQGEEGDLDLVSF---IALDEELQSTSREEIAAALESVGFDEERRAQTGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEH--TDITSLIVSHDSGFLDTVCTDIIHYENKKL. 198
66 -38.200[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  28  439.ISFENVHFSYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVR---LESLRSSIGVVPQDTVLFND-TIFHNIHYGNLSATEEEVYNAARRAAIHDTIKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLAS-NRTCIFIAHRLTTAMQ-CDEILVMEKGKVV 652
67 -38.200[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  23  6VYTMHRVGKVVPPKRHILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMAGVDKEFEGEARPQPG---------------KIGYLPQEPKLEPQQTVREAVNLEAIIQAHDGHNLDNQLERAADALRLPD-WDAKIEHLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEG---TVVAITHDRYFLDNVAGWILELDRGEG. 238
68 -37.600[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  26  504.VDFENVTFTYRTHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYD---HKYLHRVISLVSQEPVLFAR-SITDNISYGLPTVPFEMVVEAAQKANAHGFIGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQ-KHTVLIIAHRLSTVEH-AHLIVVLDKGRVV 719
69 -37.400[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  21  426.VHVVAVEVRTSAGEQLIDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTL-------------SRPDGKNETMFLSQL--YVPLGNLRGVVCYP----NAPADIPEDTVRDTLTKVALNDEERDWAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSE--PDCIIVSVSHRRAVE-LLHAQQLELLGGGQW 626
70 -37.300[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  20  442.IRFDNVPLVTPNGDVLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLTKPAKGKLFYVPQR----YMTLGTLRD--QIIYPDRPLDMIRKGVSDSDLEQMLENVQLTHILEREGGWSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK---NITLFTVSHRKSLW-KYHEYSLYMDGR... 644
71 -36.200[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  28  576.IEFSNVTFGYSPEKIVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQ---QQSLRKAIGVVPQDTVLFNN-TIFYNIEYAKLGASDEAVYEAARAADIHERIKYETKVGERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCA-NRTTIIVAHRLSTIIH-ADEILVLQQGSIA 789
72 -36.200[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  27  673ILGVHNVTFAFPSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNH--------------RLHVGRFDQHSHLTAEESAAEYLQ-------RLFNLPHEKARKALGSFGLVSHAHTIKKDLSGGQKARVALAELCLSAPDVLILDEPTNNLDIES---IDALAEAINEYEGGVIIVSHDERLIRETGCTLYVIEDQTI. 866
73 -34.900[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  25  108...............TLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGKGTVKLNGETLQS------RMLKVISAYVMQDDLLFPMLTVEETLMFAAEFRSLPKSKKKLRVQALIDQLGIRNAAKTIIGDISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPS-VLGLLDRLIFLSRGHTV 313
74 -33.600[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  28  300........NFKNETFWALKNVSFDIKEGEVVGIIGHNGAGKSTLCKLLTKILTPDEGELELSGETTSLL----------SYGTGFN-----AQLSGKDNVYLNGMLLGIPKERVAQEYPNIVAFSELEKHMDKPVKSYSSGMKSRLGFSIAATLQPDIFIIDEALSTGDVAFQQKASEKIQEMMERAKAVIIVSHSMKFVESVCTRAIWLEKGQVR 492
75 -28.100[R] COG3044 Predicted ATPase of the ABC class  ali follow..  12  225..................GELVGMGIPQGITLIVGGGFHGKSTLLTALRSVYNHIPGD----------------------------------ERMVTDVKAMKIRAEEGRCVHNLNLSNYINHLPMGKDTTDFSTQDASGSTSQSAWLQESIEAGVTTLLIDEDTSATNFMIRDERMQALVSKGEEGISTLVVMGGSGDYLDVADTVIQMHDYQPV 407

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.