current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675957|ref|NP_273075.1| BolA/YrbA family protein (NMB0009) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MLTSEQVKAMIEGVAKCEHIEVEGDGHHFFAVIVSSEFEGKARLARHRLIKDGLKAQLESNELHALSISVAATPAEWAAKAQLast
1 -50.000[K] COG5007 Predicted transcriptional regulator, BolA superfamily  ali follow..  28  6.MENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLMEYIADNRIHAVSIK-AYTPAEWARDRK 85
2 -46.100[T] KOG3348 BolA (bacterial stress-induced morphogen)-related protein  ali follow..  41  1MVTKEQVEASLTSKLKPIHLEVIGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKE--IHALSIKKAQTPQQWKPPSQ 84
3 -43.200[T] COG0271 Stress-induced morphogen (activity unknown)  ali follow..  30  16.FVPDHLEVINESYRHNVP---AGSESHFKIVIVSDKFQDQRFLSRHRSIYSVLADELAGS-VHALALH-TYTRKEWAGLQD 91
4 -37.800[T] KOG2313 Stress-induced protein UVI31+  ali follow..  33  80.LEPVELVIEDVSYQHAGHAGMKDDETHFNVKIVSKGFEGMNLVKRHRLVYHLLREELDTG-LHALSIV-SKTPSESPSKDY 161
5 -5.150[K] COG2093 DNA-directed RNA polymerase, subunit E``  ali follow..  11  25.................................LSEEWFDLVIIIDVENSEIAKKIGAKVPGKYAVRVR............. 60
6 -5.020[P] COG2967 Uncharacterized protein affecting Mg2+/Co2+ transport  ali follow..  17  1MINSPRVCIQVQSVYIEAQSSPDDER-AYTVTIRNLGRAPVQLLGRYWLITNGHGRETEVQGEGVVGVQPRIAPGE...... 78
7 -4.870[J] KOG1570 60S ribosomal protein L10A  ali follow..  11  177.......................KKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNNVRSLHVKSSMGPP....... 230
8 -4.590[R] COG0579 Predicted dehydrogenase  ali follow..  10  3......................QNDHETVDMLLVGAGIMSATVVELQESGAIESSNP-NAGTGHAGLCELNYTPQSADGS.. 76
9 -4.520[P] COG0168 Trk-type K+ transport systems, membrane components  ali follow..  18  413..........IITSTTASIATLGNIGPGLNVVGPMGTFDPIPPLGKLILIANMW------GRLEVYTVIVLFTPEFWNK... 476
10 -4.500[EH] COG0512 Anthranilate/para-aminobenzoate synthases component II  ali follow..  22  92.............................KVVRAAKVMHGKTSPITHN-VFRGLANPLTVTRYHSLVVEPDSLPACFE.... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.