current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675958|ref|NP_273076.1| phosphoglycerate kinase (NMB0010) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MAFLKLTEQNVQGKTVLIRADMNVPFKDGKISDDTRIRASLASIKYCVDNGASVIVMTHLGRPTEGEFHPEDDVAPVAAHLGSLLGKDVKVLNDWRENKPALNAGDVVMLQNVRINKGEKKNDLELGKAYASLCDVFVNDAFGTAHRAQASTEAVAQAAPVACAGVLMAGELDALGKALKQPARPMVAIVAGSKVSTKLTILESLADKVDQLIVGGGIANTFLLAEGKAIGKSLAEHDLVEESKKIMAKMAAKGGSVPLPTDVVVAKAFAADAEAVVKDIAADAEAVVKDIADVAEDEMILDIGPKSAAALADLLKAAGTVVWNGPVGVFEFDQFAGGTKALAEAIAQSKAFSIAGGGDTLAAIAKFGVTEQIGYISTGGGAFLEFLEGKELPAVAALEKRGALast
1 -107.000[G] COG0126 3-phosphoglycerate kinase  ali follow..  58  1MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLD-GVDVAEGELVVLENVRFNKGEKKDDEILSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVDEAKRLLTTCNIPVPSDVRVAT----------------EFSETAPATLKSVNDVKADEQILDIGDASAQELAEILKNAKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSIAGGGDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLEERAK 386
2 -97.100[G] KOG1367 3-phosphoglycerate kinase  ali follow..  39  3FNKLSIENLDLAGKRVLMRVDFNVPIKEGKITSNQRIVAALDSIKLALSKKAKVVLMSHLGRPD-GNKNIKYTLAPVAAELKTLLGQDVIFLSDCVGACKDPAPGSVILLENVRFYVEEEGKGKEFRASLAKLGDVYVNDAFGTAHRAHSSMMGDGFE--QRAAGLLLNKELKYFSQALDKPPNPFLAILGGAKVADKIQLIENLLDKVNEMIIGGGMAFTFLKLNNMKIGGSLFDEEGSKIVEKLVEKAKKNNVQLHLPVDFVCGDKFAENAAV----------SEATVEAGIPDGHMGLDVGPKTRELFAAPIARAKLIVWNGPPGVFEFPNFANGTKSIMDGVVKNGTVSIIGGGDTASCCAKWNTEALVSHVSTGGGASLELLEGKTLPGVAALTSA.. 415
3 -4.850[S] COG2006 Uncharacterized conserved protein  ali follow..  12  66..........FEGSTVGLKANYNSADPFPASTHPKTLSA---IVDVLKEQKAEVFMAERSGMGNTSAVLKTMGILDLAREKG-----------------------TVIDLDSYDGWVLHQPEDSHWKKGYP--VDSVIQTCCLKTHRFGGHFTMSLKNSVGMVARR--SPHMRKMIAEINVSYSPKIVIMDAIKGFSHGGPERGTVIEPGLMIAS............................................................................................................................................................................................ 260
4 -4.800[R] COG1608 Predicted archaeal kinase  ali follow..  16  1..................................................................................................................................................................................MNASTEPVILKLGGSAITDKEAALLRIAREVKMIIVHGAGSFGHTYAKKYGLGSIVTHESVKKLASRVVEALNGFGVRAIMGCTVCRNGRIESMYLESIKLMLEKGFVPVLHGDVVMDLELGTCIGDQIVPYLAKELGITRLGLGSAEDGVLDMDG-PENFEEFRQCIGGSGSTDVTGGGKVLELLELSKNSSITSYIFNA-DNIYRFLNGESI-GTRISPDKRV 260
5 -4.450[Q] COG2015 Alkyl sulfatase and related hydrolases  ali follow..  14  295..........FPQFKALWMAENNVTLRGAEVRDAKAWSKYINESIHMYAKEADVMFASH-TWPRWGNDNINHFLRKQRDMYGYIHDQALRLA-------------------NHGVTINEIQDEFHVPDVLAH--EWYNRGYHG-------SYHRNAKAVINKYLGYFDMNPATLRPLAPTDAAPKYVAAMGGM---------DNVIKLGKEAFDKG-IVDKAVFAEPSNKQARYLQADCLEQLGYQSESAGERNTYL------MGAYELRNGVPKVSATKTAGADTVVAMDTELFLDYLGVRLNGDKAAVLPDVNEKFLVELENAHLNNLKGIQSENPDMTL--TLNRAQLNQVLMGKTTIQQLAKEG-------AKIEGNA..................... 635
6 -4.400[C] COG0426 Uncharacterized flavoproteins  ali follow..  12  53..........TTYNSYLIRGEQTVLVDTSHQKFRQLYLETLKGL--INPKAIDYIIVSHTEPDHSGLVEDVLQLAPRATVLASKIALQLEGLVHDPFSKRIVKSGDRIDIGKGHEIEFVSAPNLHWPDTIFSYDRIYTCDAFGMHFCDNRTFDE-FRFYYDCLMGPNARSLLNAMKRMGDLGKIKIIANGHGPLLYHHLDVLTECYQS---------SQRQAKSETTVGLFYVADYGYSNLLVQAIGEGIQKTGVAVEM-----------------------------------------IDLSTAEIQEIQELAGRAAGLIIGMP--PTTSVAAQAGISSLLSVVKDKQAVGLFEDDEPVDTIRRKFIDLGVKEAFPA-------IRIKDVPGASAYQL... 398
7 -4.380[M] COG3980 Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase  ali follow..  13  2..............HVGIFADGGYEKGMGHVVRMKRLAEGLKILREIKSKKLDLLLFDILGAPAE-----------LLKKIKTETDAKIVLFEEKNGKSIQYSD---AVINGIYGDIRSRVYVQGNTRIYEGPDYLILHPAFQAAREDYTLKKDCRNIL--ALGG-LIFKVLAAADQVPDIKDKNMMFVMGSAKMIEQTNDMAGLMKQADAAIVAGGISLYEAICIGVPCLVLSQVEHQTATAKTFADQ.......................................................................................................................................................... 277
8 -4.140[BK] KOG1649 SWI-SNF chromatin remodeling complex, Snf5 subunit  ali follow..  12  183.............PEVLVPIRLDMEIDGQKLRDAFNMNEKLMTPEMFSE-----ILCDDLDLNPLT-------VPAIASAIRQQIESILEDQSDQRVIIKNIHVGNISLVDQFEWDMSEKENSPEFALKLCS--ELGLGGEFTIAYSIRGQLSWHQKTY------AFSENPLPTVEIAIRNTGDPLLETLTDAEMEKKIRDQDRNTRRMRRLANTG........................................................................................................................................................................................... 382
9 -3.950[R] COG0612 Predicted Zn-dependent peptidases  ali follow..  11  59...........NGLTVILSPDDSDPLHVGSAREEIGKSGFAHFFEHMMFQGSK--LITEAGNGTTNRDRTNYFETVPANQLEKMLWLEADRMGFLLDAVSQRK------FEIQRDTVKNERAQNYDNRPYGLMWEKMGEALYPEGHPYSWQTIGYVSDLDR-----VDVNDLKAFFLRWYGPNNAVLTIGGDLDVKQTLAWVQKYFGS................................................................................................................................................................................................... 261
10 -3.920[K] KOG3047 Predicted transcriptional regulator UXT  ali follow..  1..............................................................PNYRQDANKARITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTFDTHLPDGYKTQVNIGS--NVFM----------QARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQS--DVLRDESVKKRAQIKMALIAI.............................................................................................................................................................................................. 137

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.