current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675961|ref|NP_273079.1| hypothetical protein (NMB0013) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MSIYAVAHIVHLYCAIAFVGGVFFEVLVLSVLHTGRVSREARREVEKAMSYRAVRVMPFVVGLLFASGIVMAANRYLSILGEPFATSFGTMLTLKILLAFSVLAHFAIAVVKMARSTLTVGWSKYIHAVVFTHMLLIVFLAKAMFYISWLast
1 -69.700[S] COG3399 Uncharacterized protein conserved in bacteria  ali follow..  26  3.AIYPYVLVVHLLCAIIFIGYLFFDMVIFPNVK-KMFGEEFANKANTGIAQRAIKIMPLCVLGLVLTGGMMLSQYM-GGDKGWCETPFQKILMLKVILALSIFLLVLFSLSCKFLGKKN-PIGKYTHHIALAFGFLIAILAKTMWFV.. 145
2 -26.500[S] COG5615 Predicted integral membrane protein  ali follow..  14  5..ANIFLGWLHILGVVIWIGGSIVLDVILRPGSIKSLTQEQAARLGQAISKRFSPMVWISVVVVAATGVLRGARMDVLGYDALTGTTYGLILSAKLILFLAMMVIGVMIGRTGLKLAKAGDKIRKLSEVNIAIGIVVILLAVAL..... 157
3 -19.200[S] COG1981 Predicted membrane protein  ali follow..  5VAHFNLLRGLHILAVIAFMAGMLYLPRLFVYHTKATPGSQMDETFKVMERRLLRGIINPASIATAVFGLGLILADAQIRGWDFLLQPW---MIAKLVALVGLYGF-SRKKFERGENVRSEKFWRMVNEIPFVLAIVIVMSV........ 147
4 -16.000[P] COG1276 Putative copper export protein  ali follow..  16  146..IHQTNHAIHLICAAAWFGGLLPVLWCMQLIKGRW------RHQAIQALMRFSWCGHFAVIGVLASGVLNAL--LITGFPPTLTTYWGQLLLLKAMVVIALANRYVLVPRMRQDEDRAAPWFVWMTKLEWAIGAVVLVIISLL..... 284
5 -13.800[S] COG5528 Predicted integral membrane protein  ali follow..  15  2..LYFVLKFLHIIGASVLLGTGAGIAFFMLLAHRTGRTETVAAVARIVVIADFLFTAT-AVVLQPVTGIALAWNVGYSLAEGWILLSLLLYVVTGAFWLPVVWMQMEMRRLAETASKAGEPLPKRYHQLAFGAVLAIFWLMITRPALEW 157
6 -10.900[C] COG1271 Cytochrome bd-type quinol oxidase, subunit 1  ali follow..  19  15..QFAVTAIFHMLWPVLTTGMGIYLVII------EGLWLKTRNLDYYHHARFWARLYVLNFGIGVATGLPMAFQF--APFSESVGDFFGTVLGFEGTMAFMLEASFLGIMLFG------DRVPPLIHYLATILVAIGANLSTFWILSSW 154
7 -10.300[S] COG3556 Predicted membrane protein  ali follow..  13  1MWSDALLAYLHYLSIFTLIVFVTAEAVVL----RPDMTPAIRKRL-----AIYDAVYGASAGAVLISGLLLLFYGAKGVAFYVHNPVFHIKMGLFVLVALMSIPPTLAILRWKRQGKTLPAKVRRWVMLEAHLIIFIPLAAVLM..... 144
8 -9.740[S] COG3748 Predicted membrane protein  ali follow..  13  11..LTFAVRWLHVITGIAWIGSSFYFVALDLGLKQRPGMPVQKYLVAPENMPEHLIWFKWESYVTWLSGFGMLALVYYAGADLYLIDPNVLDVSKPMAIAISLASLGFGWLAYDMICRSPFGNDNTRLMVLLYFILVIVAWGYTQLF... 171
9 -9.140[TV] KOG3966 p53-mediated apoptosis protein EI24/PIG8  ali follow..  168..LFGMMWVLPIFMLSKIVSSLWFADIANAAYRVRKGRPQLIPGISKLVADFLFSMVVQMLFLVQSMLVNLVPVKYVGSSLC--------FVHLCLLYSLYSFEYKWFNMGWELHRRLTYIEKNWPYFFGFGIPLTVLIVSSCIFSIFF 313
10 -8.330[C] COG1969 Ni,Fe-hydrogenase I cytochrome b subunit  ali follow..  1....................................MQQKSDNVVSHYVFEAPVRIWHWCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIRLIHFSAGMVFTVVLLMRIYWAFVGNRYNPIAQAAMFGYFLMSVFMIITGFALY.... 151

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.