current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675966|ref|NP_273084.1|(removed signalp:1-27) pilin PilE (NMB0018) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst LPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGEWPGNNTSAGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRDKAKAANDDVTAAAAANGKKIDTKHLPSTCRDASDASLast
1 -42.800[NU] COG4969 Tfp pilus assembly protein, major pilin PilA  ali follow..  85  28LPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGEWPSNNTSAGVASSTDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLSLWAKRQDGSVKWFCGQPVKRNDTATTNDDVKADTAANGKQIDTKHLPSTCRDAASAG 170
2 -15.700[NU] COG4968 Tfp pilus assembly protein PilE  ali follow..  10  19YPSYQHYILKSHRDQAKADLVEIAQFAERFRTVNNTYAGFPATNPITQPRQGTASYLLVFVGDATRTAFTVSAVPQGTQQNDKCGTLFINQAGIKTNW............................................. 125
3 -11.400[NU] COG2165 Type II secretory pathway, pseudopilin PulG  ali follow..  11  74LPSLLGQVNKAKQSEARNYVGTANRSQQAFFLEYQRFATDLSELQVGIRTPSENYSYDIQVNGSAPNAAQFRGVAIKPALKSYYGLVGTQLGSSAVAIACESAAPSQGVDAITTF-----------------STGCATTYVS. 204
4 -7.570[U] COG4537 Competence protein ComGC  ali follow..  15  36VPNLSKQKDRVTETGNAAVVKLVENQAELYELSQGSKPS........................................................................................................ 74
5 -6.250[S] KOG4605 Uncharacterized conserved protein containing CDGSH-type Zn-finger  ali follow..  10  5...YQFYRMRITQSSVIKKSQKTGFGPNRLQRKGTHFVGTEPPVLKYHILQDKKPNEEYGLQGTNHGKVHSKLPTKVHMKKDKVYAWCSCGYSGSQPL-CDGSHNSIRIPDLKLKPVRFIPDKDMTV------CNCKQTNN.. 147
6 -5.760[S] COG5223 Uncharacterized conserved protein  ali follow..  17  29LEKRKDYAQRAQKLKRLREKALERNPDEFYHEMTHKKTKNGVPLEQREDSTIDMDTIKILKTQD............................................................................... 99
7 -5.640[L] COG1743 Adenine-specific DNA methylase containing a Zn-ribbon  ali follow..  10  581.PPYRDDVPYAELSDFYYV---LKRSLSGDGLASNTQWEGFALNEISYNEGRLRYFGVREAEDYYERLMGMAFKRLSELLKDDGLIVTYFAHSSPEAWIEAGLRVTRAWAFATESPQRVTARGKTALESSIV--VWRKRGKDG 736
8 -5.630[R] KOG2030 Predicted RNA-binding protein  ali follow..  10  894IPALQNYKFKVKLTPGGKRGKAAKLALNIFAKEKSCSAREKDLLKSIKEESLARNIPGKVKLSAPQL............................................................................ 967
9 -5.520[M] COG1970 Large-conductance mechanosensitive channel  ali follow..  4IKEFREFAMRGNVVDGVIIGAAFGKIVSSLVAD.............................................................................................................. 39
10 -5.490[C] KOG4631 NADH:ubiquinone oxidoreductase, NDUFB3/B12 subunit  ali follow..  12  11IPNYSIY----SNFRDFPQLAQHEKRLAQ.................................................................................................................. 35

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.