current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|77358700|ref|YP_338285.1| pilS cassette (NMB0020) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNSSAGVATSANIKGKYVEKVEVKNGVVTATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFYGQPVKRDNASADAVKADTAANGKQIDTKHLPSTASTRKSTPNLast
1 -28.900[NU] COG4969 Tfp pilus assembly protein, major pilin PilA  ali follow..  77  46LAEGQKSAVTEYYLNHGEWPSNNTSAGVASSTDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLSLWAKRQDGSVKWFCGQPVNDTATTNDDVKADTAANGKQIDTKHLPSTCRDAASAG. 170
2 -6.060[J] KOG4639 RNase P/RNase MRP subunit POP5  ali follow..  10  28IFQELMKLTSEMF---GDFGYSILKMSLSVRVLDEDVIV--LRVAEGGNKYFGAILPCVHKIDKQPMVLQTIFIGRSMR............................................. 101
3 -5.400[S] KOG4725 Uncharacterized conserved protein  ali follow..  16  10LAAA-KKKLKEYWQTNGSGPETATSGGGHSPGDSAPGVHGEGPTSSATL........................................................................... 72
4 -5.350[U] COG3843 Type IV secretory pathway, VirD2 components (relaxase)  ali follow..  11  563LRQRELNRVAGQLSDQLGLSYAEAQPG----ERIEGTLRRSVELASGKYAVI----------KSREFTLVPVARGEAISWTLGRQ....................................... 649
5 -5.280[J] COG1369 RNase P/RNase MRP subunit POP5  ali follow..  53LSRALSEKMLSLFGECF--------AASGLRLEAFDGERGIVRCYREALDKVMVALTLMTHVGGVRVIPLTLGVSGTIK............................................. 123
6 -5.070[S] COG4872 Predicted membrane protein  ali follow..  9LGAAVIMLVAANWQEMPRLMRIGVIFVLIWASYLGGAWRQA-VFPAALYVLGAASFGAGIALVGQMYHISGDVYSAALYWTLGV........................................ 95
7 -5.040[M] COG3770 Murein endopeptidase  ali follow..  11  282.................................................................................CDKSLADEPWKPAKPSGKPAKKPKPVMVSDLPKACAAVLNGPA 328
8 -4.920[J] COG2139 Ribosomal protein L21E  ali follow..  12  9..SRTRYMFQRDFRKHGAVHMSTYLKIYKVGDIVD-GKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHS---KCRQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRES..... 138
9 -4.890[R] COG3019 Predicted metal-binding protein  ali follow..  14  73.HASCHTAVIDGYVIEGHVPAEDIKRLLAEKPDAVGLSAPGMPIGSPGM........................................................................... 120
10 -4.820[S] KOG4176 Uncharacterized conserved protein  ali follow..  16  223.....QLTVNEYEPGHGIPPHVDTHSAF-------LDPILSLSLQSDVVMDFRRGDDVQVRLPRRSLLIM--SGEARYDWTHGIRPKHIDVVPSASGGLTTQARGSLTFRRLPCDCS....... 332

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.