current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675964|ref|NP_273082.1| hypothetical protein (NMB0016) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -7.280IDP06124 hypothetical protein jhp0592 [Helicobacter pylori J99] NP_223310 [Helicobacter pylori J99]  ali follow..  23  2......GNLTYYAYMYLILFVCLLPVLL-VGLAWRLTRPPLKQNIPNKSLSLENLNEQIKNL................ 56
2 -6.660IDP02752 gene: grxB; glutaredoxin 2 [Francisella tularensis subsp. tularensis SCHU S4] FTT0650c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  1...............MKIYLYHHCPYCIKVRLVADL-SNFDYQMIILANDDEKAHIDRIGSKQVPFLEKDDGT..... 57
3 -6.280IDP00895 gene: grxB; glutaredoxin 2 STM1165 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  1...............MKLYIYDHCPFCVKARMIFG-LKNIPVELNVLQNDDEATPTRMIGQKMVPILQKDDSR..... 57
4 -5.490IDP92048 thioredoxin, putative [Toxoplasma gondii ME49] TGME49_049270 [Toxoplasma gondii ME49]  ali follow..  16  53...............IVEFYADWCGHCQRFAPEFEKAAKALRGIVTLVAVSDQSAMGEYGVQGFPTVKAFVGRGG... 112
5 -4.950IDP06445 gene: H3L; H3L [Monkeypox virus Zaire-96-I-16] NP_536520 [Monkeypox virus Zaire-96-I-16]  ali follow..  23  281...SFFGLFDINVIGLILFIMFMLIFNVKSKLLWFLTGTFVTAFI................................. 324
6 -4.780IDP92795 gene: csy2; Csy2 [Vibrio phage ICP1_2011_A] AGG09392 [Vibrio phage ICP1_2011_A]  ali follow..  15............INAKSSDITVGMPATTFCGLGETMSIKTGIVVKAVSYGSVKFEVRGSRFNTSVTKFAWQDRGN... 78
7 -4.640IDP01937 putative periplasmic solute-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0727 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  29.........AAQAEGRVNSLAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEKKNASGDI......... 88
8 -4.230IDP06016 putative metalloproteinase TLN4 [Toxoplasma gondii] ADX66727 [Toxoplasma gondii]  ali follow..  29 1623LERCAADQNAADAKRIVVFFTD--PVEARRSILENLEAKLS-SLFSLSPSSHPSLWLAYSRSESCSIRTSSRAEEVCG 1706
9 -4.190IDP06216 hypothetical protein HP0408 [Helicobacter pylori 26695] NP_207206 [Helicobacter pylori 26695]  ali follow..  18  2..NIFQTSLKCCVGGVLLGDSKAFKVRVDKSLTPPFLNVLSLAFKQDMKKEVIFVITKSNKLSKKVLC.......... 72
10 -4.040IDP90101 gene: sseL; deubiquitinase [Salmonella typhimurium LT2] STM2287 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  262.....CGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQ................. 317

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 5 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]