current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|15675964|ref|NP_273082.1| hypothetical protein (NMB0016) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MKNSFCGQFACCANGILLFFTEWLPMSLRTGILWRFERKVCLELVEMVRCRHECLISAYRQSAHPNLCISGGKNEICGLast
1 -6.890sp|Q9Y4G2|PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens GN=PLEKHM1 PE=1 SV=3 (Range: 301-600)  ali follow..  25  228LSNPFRGLMKL-AMGI--LFCELSPLEFR--LYLSNEEHTCVENCSLLRCES---VGPAHSDGRFELVFSG....... 300
2 -6.870sp|P20916|MAG_HUMAN(removed signalp:1-19) Myelin-associated glycoprotein OS=Homo sapiens GN=MAG PE=1 SV=1 (Range: 451-607)  ali follow..  14  17........VICTARNLYGAKSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKKNVTESPSFSAGD... 83
3 -6.840sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 (Range: 151-450)  ali follow..  20  92.ENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCR..... 163
4 -6.830sp|Q9Y2G1|MRF_HUMAN Myelin gene regulatory factor OS=Homo sapiens GN=MRF PE=1 SV=3 (Range: 901-1151)  ali follow..  16  128ITSQYCAPGDACRPGNFTYVSSGTPLHLSLTLQMNSSSPVSVVLCSLRSKEEPCEEGSLPQSLHTHQDTQGTSHR... 205
5 -6.600sp|Q9NXE8|CWC25_HUMAN Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens GN=CWC25 PE=1 SV=1  ali follow..  20  2............GGGDLNLKKSWHPQTLRN--VWKAEQKHEAERKKIEELQRELREERAREEMQRYAEDVGAVKK... 65
6 -6.420sp|Q9NX94|OPA1L_HUMAN Outcome predictor in acute leukemia 1 OS=Homo sapiens GN=OPA1L PE=2 SV=2  ali follow..  20  26.TGHCCGQSQCCNYYYELFWLVWTIIIILSCCCVCHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFY........ 96
7 -6.370sp|P13667|PDIA4_HUMAN(removed signalp:1-24) Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 (Range: 301-600)  ali follow..  13  223...............LIEFYAPWCGHCKQLEPVYNYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFEGGDRDL.. 300
8 -6.290sp|Q8TDY8|IGDC4_HUMAN(removed signalp:1-24) Immunoglobulin superfamily DCC subclass member 4 OS=Homo sapiens GN=IGDCC4 PE=2 SV=1 (Range: 901-1200)  ali follow..  32  8......GPFSRLQDVITL-LSDSLDMHSVTGII------VCLGLL----CLLACMCAGLRRSPHRES........... 62
9 -6.230sp|Q5VYM1|CI131_HUMAN Uncharacterized protein C9orf131 OS=Homo sapiens GN=C9orf131 PE=2 SV=3 (Range: 1-300)  ali follow..  25  2.....................EWLLEDLLGGLLW--------QLTHALACRHCGSSCFQSPGNLVTLFLF........ 48
10 -6.200sp|Q9P2K2|TXD16_HUMAN(removed signalp:1-27) Thioredoxin domain-containing protein 16 OS=Homo sapiens GN=TXNDC16 PE=2 SV=4 (Range: 151-450)  ali follow..  11  219LTEETFNATVMASDSIVLFYAGWQAVSMAFLQSYKLKGTSTMLLTRINCADWSDVCTKQNVTEFPIIKMKKGENPV.. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 5 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]