current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: tr|A0AVG2|A0AVG2_HUMAN TRPM8 protein OS=Homo sapiens GN=TRPM8 PE=2 SV=1 (Range: 311-360), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst TRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELAVEATDQHFIAQPLast
1 -4.020[W] KOG3848 Extracellular protein TEM7, contains PSI domain (tumor endothelial marker in humans)  ali follow..  17  470..AILVTVYMYHHPTSAASIFFIERRPSWGHPAYAEVEPVGEKEGFIV.. 525
2 -3.040[S] COG4628 Uncharacterized conserved protein  ali follow..  36.LDTAMRFNCFHTKPSIASSVKYLNKTEWAREKLENF............. 71
3 -3.020[TK] COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain  ali follow..  15  74..GLNIIEAIRSRRADTRAIVLT----GYGNIATAVNAVKLGAIDYLSKP 117
4 -3.010[D] KOG4456 Inner centromere protein (INCENP), C-terminal domain  ali follow..  19  62......LNDLNSDDETDQEDDPRKDVPAWAEFAVVRENVRRH........ 97
5 -2.970[P] COG2837 Predicted iron-dependent peroxidase  ali follow..  20  365....GLLFVCYQHDLEKGFLTVQKR---LNGEALEEYVKPIGGGYFFALP 407
6 -2.790[L] COG2356 Endonuclease I  ali follow..  10  173ARTYFYMRDHYNLTLSRQQTQLFNA---WDKMYPVT-KVQGNHNPYVQRA 229
7 -2.780[S] KOG3455 Predicted membrane protein  ali follow..  16  33.....LYEKLYTGKPNLVNGLQARTFGIWTLLSSVIRCLCA......... 68
8 -2.730[R] KOG4144 Arylalkylamine N-acetyltransferase  ali follow..  10  15..VSKLEAICFPEAERASFARIKDRVKRAPEIQLGLFAPTQHTSTLIGH. 61
9 -2.670[R] COG0613 Predicted metal-dependent phosphoesterases (PHP family)  ali follow..  18  137.FAKWLVDNGYATNMQQVFKYLTRDNPGYSMSEAVSAIHAAGGQAVLAHP 192
10 -2.630[K] COG3682 Predicted transcriptional regulator  ali follow..  15  8...AHVMEALWRRSPLSADELVVGAAQSWGEATVKTLINRLLKKKAIKS. 55

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.