current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens GN=SECISBP2 PE=1 SV=2 (Range: 1-149), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MASEGPREPESEGIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFVQEPPVTEQKIYTEDMAFGASTFPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDLast
1 -10.100[R] KOG1777 Putative Zn-finger protein  ali follow..  11  1...............MSSSSSPFPPQQVMDDTTQQSPSYSQPSQHTFESMEPAAG---GSTSMRYSPSGS-SEADNPTLGLFSAQASYPYSCFPITAATADETPQPTMKKFKLELSPGEARDFSIEDESGTNLEAKMETTECEPEEEEA 152
2 -6.850[T] KOG4293 Predicted membrane protein, contains DoH and Cytochrome b-561/ferric reductase transmembrane domains  ali follow..  16  401VWRDLYAERFAISSDMKEKFSALEGRVSGLESGGYENPNPAQVSSFSTSLPPFVT.............................................................................................. 455
3 -6.060[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  771.ANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPHRRGPRRADRREEELVASAP.. 917
4 -5.880[S] KOG4647 Uncharacterized membrane protein  ali follow..  1MGEQGEETGQKLTERSTKE-AYFESLAEWAKQATLAQNAMLMFPYYLMANYPTMFPGLPSSAALQAAAMGQPQALVQGSAAAPGEPAAEPRLPAPNFSGLRILGEAAQLDIIQRLGG................................ 116
5 -5.420[C] COG1153 Formylmethanofuran dehydrogenase subunit D  ali follow..  53LKNSFGTIVVKAEESGYETPHRYMPNSPWSNMLVSDGTGGTGVPKF....................................................................................................... 101
6 -5.290[R] KOG4431 Uncharacterized protein, induced by hypoxia  ali follow..  20  1MSSNSLFETDEDVAQANVKESPFML............................................................................................................................ 30
7 -5.250[S] KOG2490 Predicted membrane protein  ali follow..  2..GSNTSPGQADPLESENESSLTSRFLPNKRDGGKDNESVIPEKEEPDLNEPVLAVPLPKSRYALTKRSSSSEYPRRSASTSAKKNVIPITRSYSTTFFSKTNDQPTVTGNQDKPISRLRASKLQIQNFWNYICFELLANDTVPANPI. 147
8 -5.150[J] KOG3184 60S ribosomal protein L7  ali follow..  19  292......RIEQSPPIELDTSQ-SYIAVYTHLKVHATMMPERLPTPEAIGR.................................................................................................... 333
9 -5.120[O] KOG3488 Dolichol phosphate-mannose regulatory protein (DPM2)  ali follow..  24  29...................ILPFVDSDHFIHKYFLPQDYAILVP......................................................................................................... 53
10 -5.100[T] KOG3858 Ephrin, ligand for Eph receptor tyrosine kinase  ali follow..  16  292.SGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGH-------PVYIVQEMP----PQSPANIYYK................................................................................... 345

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.