current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens GN=SECISBP2 PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
2 -8.170IDP91542 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_080410 [Toxoplasma gondii ME49]  ali follow..  10  1...............MAAESSPSGPIESA-DESPTRSSTSSLDPDQQTSSLPSLRE--SPRASASSSGVASKAGEGP-TFLPQRLHEATPPQDGALPAASGHGHTDAETHAQGANPGEARPEIQAGPDSDSKTSSSPLSFLTS...... 136
3 -7.970IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  848.LSETGNSTSNSTLEEVPTVDP-KVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGDPMLDPALEEAPAVDPVQEKL 998
6 -5.490IDP95320 conserved hypothetical protein [Vibrio cholerae MAK 757] EFH77921 [Vibrio cholerae MAK 757]  ali follow..  10  1MSNPNQAAKTGQTNDAQNPASGIIPVRYAFDVYDDQGQALHPLPSYTLR-WLYVYDETAKTLHEYE................................................................................... 94
7 -5.430IDP93844 putative cytotoxic protein [Yersinia enterocolitica subsp. enterocolitica WA-314] EKA25321 [Yersinia enterocolitica subsp. enterocolitica WA-314]  ali follow..  16  4................QPGSAPVFPQHTGTDIRFLATKRTLTFLA-YIIWFP................................................................................................. 46
9 -4.670IDP90118 alpha-amanitin target protein [Monkeypox virus] MPXV_ZAI1979_005_028 [Monkeypox virus]  ali follow..  17  1MTSSAMDNNEPKVLEMVYD-ATILPECSGMDPSIID................................................................................................................. 35
10 -4.540IDP05089 putative prophage LambdaBa02, lipoprotein [Bacillus phage lambda Ba03] BA_4065 [Bacillus anthracis str. Ames]  ali follow..  17  25SSSASKNTTKNEAKEIPTEVRSFVTNFNGILDENGSSTNTEKLSKDL...................................................................................................... 71

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.