current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAHLast
1 -86.800sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   100  38KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 212
2 -84.000sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali   49  46RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAF 220
3 -60.500sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   100  188KKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAI.............................................................. 300
4 -56.800sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali   52  196RKLHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRER....................................................................... 299
5 -33.300sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali   45  1.........................................................................................................ELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAF 70
6 -26.600sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   100  1.................................................................................................................SIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH 62
7 -12.100sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   11  15.......LGDEVFRFQLTLYPDATEGE------KLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVMKDLAQKSFRLLMDINLKAPVIIIPQSSVS------PNAVIADLGLIRVENKFSLVPMEHYSLPPVIDKMN............................... 158
8 -11.700sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   13  130.................................VLSLNVGCIQIVYLHKFLMSLLNFLNNFQTAKESLSAATAVKDLAQRSFRVSINIDLKAPVIVIPQSSIST------NAVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMD............................... 243
9 -11.200sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   12  140.......SGEEALIFQTFKYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAVRDQAQRCSRVLLDIEAGAPVLLIPESSRS------NNLIVANLGKLKVKN................................................... 256
10 -11.100sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   13  1..................KYGRPDPLLRREHDIRVSLRMASVQYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAVRDQAQRCSRVLLDIEAGAPVLLIPESSRS------NNLIVANLGKLKVKN................................................... 106
11 -10.600sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   11  3.......TTSSLLKIKFETNPEDSPADQ-----TLIVQSQPVEVIYDAKTVNAVVEFFQSNKGLDLEQRTATGLTHIIETRKVLDLRINLKPSYLVVP---QTGFHHEKSDLLILDFGTFQLNSKDQGLQKTTNSSLEEIMD................................. 143
12 -10.600sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2  ali   98.................................QVNLIVGCIEVVFVTKFLYSILAFIDNFQAAKQALAEATVVKELAQRSSRMALDINIKAPVVVIPQSPVS------ENVFVADFGLITMTNTFHMITESQSSPPPVIDLIT............................... 211
13 -10.500sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   13  195.................................KLSFKVGCIQIVYVHKFFMSLLNFLNNFQTAKEALSTATVMKDLAQKSFRLLMDINLKAPVIIIPQSSVS------PNAVIADLGLIRVENKFSLVPMEHYSL....................................... 300
14 -9.820sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   13  153.......TTSSLLKIKFETNPEDSPADQ-----TLIVQSQPVEVIYDAKTVNAVVEFFQSNKGLDLEQRTATGLTHIIETRKVLDLRINLKPSYLVVPQTGFHHEKSD---LLILDFGTFQLNSDQGLQKTTNSSLEEIMDKA................................ 295
15 -9.600sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   11  83.................................FLNLKMASLHYNHSAKFLKELTLSMDELEENFRGMIYGFDLASSHLDTVKLILNINIESPVVSIPRKPGS------PELLVGHLGQIFIQNFVAGDDESRSDRLQV.................................... 224
16 -9.160sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2  ali   12  110.......DAMSLFQITFEINPLDETVSQ-----RCIIEAEPLEIIYDARTVNSIVEFFRPPKEVHLAQKTATGLLYIIETQKVLDLKINLKASYIIVPQDGIFSPTSN---LLLLDLGHLKVTSKSRSELPDVKQGEANLKEIMDRAY-----DSFDIQLTSVQLL......... 269
17 -9.030sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   13  154.......PDGPVFEMLYERNPAHSHFER-----RLNVSTRPLNIIYNPQAIKKVADFFYQTKAEIRQTLDRLLVGDFIEESKRWTVRLDISAPQVIFP----DDFKFKNPVLVVVDLGRMLLTNTQDNSR............................................. 299

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.