current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: tr|A0AVG2|A0AVG2_HUMAN TRPM8 protein OS=Homo sapiens GN=TRPM8 PE=2 SV=1 (Range: 240-290), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst DVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKTLALast
1 -37.800tr|A0AVG2|A0AVG2_HUMAN TRPM8 protein OS=Homo sapiens GN=TRPM8 PE=2 SV=1 (Range: 240-290)  ali  100  1DVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKTLA 51
2 -30.200sp|Q9BX84|TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens GN=TRPM6 PE=1 SV=2 (Range: 603-742)  ali follow..  23  2.....FLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMA 47
3 -30.200sp|O94759|TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens GN=TRPM2 PE=1 SV=2 (Range: 616-750)  ali follow..  50  3.....TMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELS 48
4 -29.100sp|Q8TD43|TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens GN=TRPM4 PE=1 SV=1 (Range: 553-687)  ali follow..  32  3.....GQAPWSDLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA 48
5 -27.300sp|Q7Z4N2|TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens GN=TRPM1 PE=1 SV=2 (Range: 611-769)  ali follow..  30  1........PFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMA 43
6 -25.000sp|Q9NZQ8|TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens GN=TRPM5 PE=1 SV=1 (Range: 521-665)  ali follow..  41  1............LFLWAVLQNRHEMATYFWAMGQEGVAAALAACKILKEMS 39
7 -5.600sp|P0C881|R10B1_HUMAN Radial spoke head 10 homolog B OS=Homo sapiens GN=RSPH10B PE=2 SV=1 (Range: 471-571)  ali follow..  12  9...EEIHSPFTTILLRTFLNYLLHLAYHIYHEEFQKRSPSLFLC....... 49
8 -5.180sp|B2RC85|R10B2_HUMAN Radial spoke head 10 homolog B2 OS=Homo sapiens GN=RSPH10B2 PE=2 SV=2 (Range: 471-571)  ali follow..  12  9...EEIHSPFTTILLRTFLNYLLHLAYHIYHEEFQKRSPSLFLC....... 49
9 -4.210tr|B4DJT1|B4DJT1_HUMAN Uncharacterized protein OS=Homo sapiens GN=DPCD PE=2 SV=1 (Range: 156-246)  ali follow..  14  1......RLPWQRL---GVLLSRGKMAVTGWLESLRTAQKTALLQDGNSRV. 41
10 -4.210sp|Q8NHH9|ATLA2_HUMAN Atlastin-2 OS=Homo sapiens GN=ATL2 PE=1 SV=2 (Range: 522-583)  ali follow..  14  15.......................QIAETLWEQVLKPLGDNLMEENIRQSVT 42

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.