current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: tr|A0AVG2|A0AVG2_HUMAN TRPM8 protein OS=Homo sapiens GN=TRPM8 PE=2 SV=1 (Range: 311-360), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst TRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELAVEATDQHFIAQPLast
1 -48.500tr|A0AVG2|A0AVG2_HUMAN TRPM8 protein OS=Homo sapiens GN=TRPM8 PE=2 SV=1 (Range: 311-360)  ali  100  1TRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELAVEATDQHFIAQP 50
2 -36.000sp|Q9HCF6|TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens GN=TRPM3 PE=2 SV=4 (Range: 703-800)  ali follow..  44  25QLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHT 74
3 -30.200sp|Q9BX84|TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens GN=TRPM6 PE=1 SV=2 (Range: 603-742)  ali follow..  30  72QLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHT 121
4 -29.800sp|O94759|TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens GN=TRPM2 PE=1 SV=2 (Range: 616-750)  ali follow..  48  69HRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHG 118
5 -29.200sp|Q9NZQ8|TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens GN=TRPM5 PE=1 SV=1 (Range: 521-665)  ali follow..  42  58RLALDLFSECYSNSEARAFALLVRRNRCWSKTTCLHLATEADAKAFFAHD 107
6 -29.200sp|Q8TD43|TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens GN=TRPM4 PE=1 SV=1 (Range: 553-687)  ali follow..  44  69GMGVDLFGECYRSSEVRAARLLLRRCPLWGDATCLQLAMQADARAFFAQD 118
7 -28.600sp|Q7Z4N2|TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens GN=TRPM1 PE=1 SV=2 (Range: 611-769)  ali follow..  42  68QLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHT 117
8 -23.000sp|Q9Y210|TRPC6_HUMAN Short transient receptor potential channel 6 OS=Homo sapiens GN=TRPC6 PE=1 SV=1 (Range: 316-404)  ali follow..  24  12DFVVGLLDLCRNTEEVEAILNGDVETLQSGDHSRLKLAIKYEVKKFVAHP 66
9 -23.000tr|E9PJN4|E9PJN4_HUMAN Uncharacterized protein OS=Homo sapiens GN=TRPC6 PE=4 SV=1 (Range: 316-404)  ali follow..  24  12DFVVGLLDLCRNTEEVEAILNGDVETLQSGDHSRLKLAIKYEVKKFVAHP 66
10 -21.900sp|Q9HCX4|TRPC7_HUMAN Short transient receptor potential channel 7 OS=Homo sapiens GN=TRPC7 PE=1 SV=1 (Range: 261-351)  ali follow..  20  12DFVVGVLDLCRDTEEVEAILNGDVNFQVWSDHSRIKLAIKYEVKKFVAHP 66
11 -20.700sp|P48995|TRPC1_HUMAN Short transient receptor potential channel 1 OS=Homo sapiens GN=TRPC1 PE=1 SV=1 (Range: 256-350)  ali follow..  22  12MFAKDLLAQARNSRELEVILNHTSSDEPLDKRSRLKLAIKYNQKEFVSQS 70
12 -20.600sp|Q9UL62|TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens GN=TRPC5 PE=1 SV=1 (Range: 239-327)  ali follow..  22  12LFAKDLLDQARSSRELEIILNEELDPQKYHDLAKLKVAIKYHQKEFVAQP 67
13 -19.200sp|Q9UBN4|TRPC4_HUMAN Short transient receptor potential channel 4 OS=Homo sapiens GN=TRPC4 PE=1 SV=1 (Range: 239-327)  ali follow..  24  12QFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGLKLAIKYRQKEFVAQP 66
14 -16.300sp|Q13507|TRPC3_HUMAN Short transient receptor potential channel 3 OS=Homo sapiens GN=TRPC3 PE=1 SV=3 (Range: 245-339)  ali follow..  20  12DFVVGVLDLCRDSEEVEAIAEPLEVHRHKASLSRVKLAIKYEVKKFVAHP 68

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.