current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0AVI2|FR1L5_HUMAN Fer-1-like protein 5 OS=Homo sapiens GN=FER1L5 PE=2 SV=2 (Range: 1641-1750), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst AKRKGLPPPLFSPEEDAVFYNGKKFKLQSFEPKTPTVHGLGPKKERLALYLLHTQGLVPEHVETRTLYSHSQPGIDQGKVQMWVDIFPKKLGPPGPQVNINPRKPKRKASLast
1 -83.500sp|A0AVI2|FR1L5_HUMAN Fer-1-like protein 5 OS=Homo sapiens GN=FER1L5 PE=2 SV=2 (Range: 1641-1750)  ali  100  1AKRKGLPPPLFSPEEDAVFYNGKKFKLQSFEPKTPTVHGLGPKKERLALYLLHTQGLVPEHVETRTLYSHSQPGIDQGKVQMWVDIFPKKLGPPGPQVNINPRKPKRKAS 110
2 -76.500sp|O75923|DYSF_HUMAN Dysferlin OS=Homo sapiens GN=DYSF PE=1 SV=1 (Range: 1705-1811)  ali follow..  48  2CQQHRVKAPVYRT--DRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRF.. 107
3 -51.200sp|Q9HC10|OTOF_HUMAN Otoferlin OS=Homo sapiens GN=OTOF PE=1 SV=3 (Range: 1592-1714)  ali follow..  35  29CKDGKVDGPHFGPP-GRVKVANRVFTGPSEIEDE--NGQRKPTDEHVALLALRHWRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMD.................... 123
4 -49.700sp|Q9NZM1|MYOF_HUMAN Myoferlin OS=Homo sapiens GN=MYOF PE=1 SV=1 (Range: 1675-1754)  ali follow..  48  7ARFKGFPQPILSEDGSRIRYGGRDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHSTFQPN.................................... 80
5 -25.500sp|Q2WGJ9|FR1L6_HUMAN Fer-1-like protein 6 OS=Homo sapiens GN=FER1L6 PE=2 SV=2 (Range: 1494-1553)  ali follow..  28  2.............HPGKIQIGNQVFSGKTIFTEED-TDETVESYEHLALKVLHSWELVPEHIETR............................................. 60
6 -6.910sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens GN=ZBTB7C PE=1 SV=1 (Range: 219-284)  ali follow..  17  5............................................RDFSIESLLRENLYPK-PDRRPSLSPFAPDF-----HLWPGDFGAFAQLPEQPMDSGP........ 61
7 -6.560sp|Q96G46|DUS3L_HUMAN tRNA-dihydrouridine synthase 3-like OS=Homo sapiens GN=DUS3L PE=1 SV=2 (Range: 576-650)  ali follow..  21  17.......................................................ERLPQRINERPPYYLGRDYLESQKAADWIRISEMLLGPVPPSFAFLPKHKAN... 72
8 -6.200sp|Q5VWN6|CJ018_HUMAN Uncharacterized protein C10orf18 OS=Homo sapiens GN=C10orf18 PE=1 SV=1 (Range: 731-804)  ali follow..  25  37...........................................................EKTVVRALHGPWNTDLPDNVLHMWVALF....................... 70
9 -5.980tr|B1AKM8|B1AKM8_HUMAN Phosphatidylserine decarboxylase (Fragment) OS=Homo sapiens GN=PISD PE=4 SV=1 (Range: 1-130)  ali follow..  10  74...................................................VALYKSVPTRLLSR-LNQVELP-LRRPVYSLYIWTFGVNMK------EAAVEDLHHYRN 130
10 -5.980tr|B1AKM6|B1AKM6_HUMAN Phosphatidylserine decarboxylase OS=Homo sapiens GN=PISD PE=4 SV=1 (Range: 1-130)  ali follow..  10  74...................................................VALYKSVPTRLLSR-LNQVELP-LRRPVYSLYIWTFGVNMK------EAAVEDLHHYRN 130

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.