current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0AVI2|FR1L5_HUMAN Fer-1-like protein 5 OS=Homo sapiens GN=FER1L5 PE=2 SV=2 (Range: 2018-2093), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst APHYLAMSWIKPQLQLYPPIKIFNIINSLNTSNASSSILPTQDPNLKPTIDHEWKLHPGPTNHLSDIFPELPAPGDLast
1 -71.100sp|A0AVI2|FR1L5_HUMAN Fer-1-like protein 5 OS=Homo sapiens GN=FER1L5 PE=2 SV=2 (Range: 2018-2093)  ali  100  1APHYLAMSWIKPQLQLYPPIKIFNIINSLNTSNASSSILPTQDPNLKPTIDHEWKLHPGPTNHLSDIFPELPAPGD 76
2 -6.070sp|Q9Y4D2|DGLA_HUMAN Sn1-specific diacylglycerol lipase alpha OS=Homo sapiens GN=DAGLA PE=1 SV=3 (Range: 594-664)  ali follow..  12  5..............PLYPPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPY...... 60
3 -5.740tr|E9PRJ1|E9PRJ1_HUMAN Uncharacterized protein OS=Homo sapiens GN=AGBL2 PE=4 SV=1 (Range: 1-148)  ali follow..  20  97..........EVNPRLREPQELFSILSTKRPLQA-------------PRWPIECEVIKENIHHI-EWAPPQPEY.. 146
4 -5.670sp|Q6W2J9|BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens GN=BCOR PE=1 SV=1 (Range: 183-300)  ali follow..  26  1GASYLRLPWVNPYMEGATP-AIYPFLDSPNKYSLNKALLPQQSYSL.............................. 47
5 -5.420tr|E9PQV6|E9PQV6_HUMAN Uncharacterized protein OS=Homo sapiens GN=MICU1 PE=4 SV=1 (Range: 112-178)  ali follow..  20  1......MEYENRIRAYSTPDKIFRYFATLKVISEPG----------------EAEVFMTPEDFVRSITPNEKQPEH 54
6 -5.200tr|B3KUB2|B3KUB2_HUMAN Uncharacterized protein OS=Homo sapiens GN=RGS3 PE=2 SV=1 (Range: 145-204)  ali follow..  31  41.PNYIILAPLNPGSQLLRPV........................................................ 59
7 -5.200sp|P49796|RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens GN=RGS3 PE=1 SV=2 (Range: 426-485)  ali follow..  31  41.PNYIILAPLNPGSQLLRPV........................................................ 59
8 -5.030sp|Q502W7|CCD38_HUMAN Coiled-coil domain-containing protein 38 OS=Homo sapiens GN=CCDC38 PE=2 SV=1 (Range: 318-477)  ali follow..  14  14..........EPALYFKEPEELLQVLRELEEQNLTSQDVDENLEEVNKREKVIQDKTNSNIEFLLEQEKMLKA... 80
9 -4.990sp|Q8IZQ8|MYCD_HUMAN Myocardin OS=Homo sapiens GN=MYOCD PE=1 SV=1 (Range: 882-938)  ali follow..  20  8.....TMEWL--DLTPPNSTPGFSALTTSSPSIFNIDFLDVTDLNLNSSMDLHLQ..................... 55
10 -4.990sp|Q8WYQ5|DGCR8_HUMAN Microprocessor complex subunit DGCR8 OS=Homo sapiens GN=DGCR8 PE=1 SV=1 (Range: 60-169)  ali follow..  16  40ARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVH.............. 101

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.