current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0AVK6|E2F8_HUMAN Transcription factor E2F8 OS=Homo sapiens GN=E2F8 PE=1 SV=1 (Range: 470-543), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst KPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPTLast
1 -50.900sp|A0AVK6|E2F8_HUMAN Transcription factor E2F8 OS=Homo sapiens GN=E2F8 PE=1 SV=1 (Range: 470-543)  ali  100  1KPVAPLDPPVNAEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGLSPT 74
2 -6.140sp|Q5SW24|DACT2_HUMAN Dapper homolog 2 OS=Homo sapiens GN=DACT2 PE=2 SV=1 (Range: 219-291)  ali follow..  15  54.....................................................VYPYPSPLHAVALQSPLFV.. 72
3 -5.770sp|Q14C86|GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens GN=GAPVD1 PE=1 SV=2 (Range: 1120-1258)  ali follow..  13  47.....IAEAINLQDKNLMAQLQETMRCVCRFDNRCRKLLASIAEDYRKRAPYIAYLTRCRQGLQTT........ 108
4 -5.750sp|Q6EMB2|TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens GN=TTLL5 PE=1 SV=3 (Range: 464-542)  ali follow..  18  22.........................................IFPTSETWEIYGSYLEHKTSMNYMLAT...... 48
5 -5.260sp|Q6NXP0|CC025_HUMAN EF-hand domain-containing protein C3orf25 OS=Homo sapiens GN=C3orf25 PE=2 SV=1 (Range: 505-572)  ali follow..  21  3...............................PGHLLDKLQLYLPTVATDRSLALFSCVQHQPHV.......... 35
6 -5.200sp|Q7L5A8|FA2H_HUMAN Fatty acid 2-hydroxylase OS=Homo sapiens GN=FA2H PE=1 SV=1 (Range: 110-167)  ali follow..  14  20.......................................PLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEG 54
7 -5.030sp|A6NCM1|IQCAL_HUMAN Putative IQ and AAA domain-containing protein 1-like OS=Homo sapiens GN=IQCA1P1 PE=5 SV=2 (Range: 269-329)  ali follow..  53  49..........................................YPDASSGGSYSIF................... 61
8 -4.930tr|F1LLU9|F1LLU9_HUMAN Uncharacterized protein OS=Homo sapiens GN=WDR6 PE=4 SV=1 (Range: 1-61)  ali follow..  33  43.............................LPATSASQVQVILLPQPP........................... 60
9 -4.790sp|Q7Z6K1|THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens GN=THAP5 PE=1 SV=2 (Range: 179-314)  ali follow..  17  82..........................TVEELNTNKESVIAIFVPAENSKPSVNSFISAQK.............. 115
10 -4.780sp|Q9H5I5|PIEZ2_HUMAN Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens GN=PIEZO2 PE=2 SV=2 (Range: 290-356)  ali follow..  17  10...............PPNDYYARLFGIKSVIQTDCSSTWKIIV---NPDLSWYHHANP................ 49

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.