current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0PJM3|GORL_HUMAN Putative exonuclease GOR-like protein OS=Homo sapiens GN=REXO1L2P PE=5 SV=2 (Range: 195-290), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst SSGCQVPTVLRRGYLQLFTEECLKFCASKQEAEEKALNEEKVAYDCSPNKNRYLNVVLNTLKRLKGLTPSSMPGLSRAALYSRLQEFLLTQDQLKELast
1 -67.800sp|A0PJM3|GORL_HUMAN Putative exonuclease GOR-like protein OS=Homo sapiens GN=REXO1L2P PE=5 SV=2 (Range: 195-290)  ali  100  1SSGCQVPTVLRRGYLQLFTEECLKFCASKQEAEEKALNEEKVAYDCSPNKNRYLNVVLNTLKRLKGLTPSSMPGLSRAALYSRLQEFLLTQDQLKE 96
2 -66.300sp|Q8IX06|GOR_HUMAN Exonuclease GOR OS=Homo sapiens GN=REXO1L1 PE=2 SV=2 (Range: 288-382)  ali follow..  100  1.SGCQVPTVLRRGYLQLFTEECLKFCASKQEAEEKALNEEKVAYDCSPNKNRYLNVVLNTLKRLKGLTPSSMPGLSRAALYSRLQEFLLTQDQLKE 95
3 -47.000sp|P0C843|CI014_HUMAN Putative uncharacterized protein encoded by LINC00032 OS=Homo sapiens GN=LINC00032 PE=5 SV=1 (Range: 36-101)  ali follow..  36  1...SKVPDEVRQRYINLFVEKYLKVCKTEDEAVYKAKIEKKAIYERCSRRNMYVNIAVNYLKKLRDQGA........................... 66
4 -43.000sp|Q8N1G1|REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens GN=REXO1 PE=1 SV=3 (Range: 803-866)  ali follow..  71  6EFGGKVPTVIRQRYLNLFIEECLKFCTSNQEAIEKALNEEKVAYDRSPSKNIYLNVAVN..................................... 64
5 -7.060sp|Q8TBZ2|MYBPP_HUMAN MYCBP-associated protein OS=Homo sapiens GN=MYCBPAP PE=1 SV=2 (Range: 521-616)  ali follow..  12  31..ESKLTAHEAVTVVREVLQELLMGVLTPERTPSDAYLTEEDLFRHRNPPLHYEHQVVQSLHQLWR.............................. 96
6 -6.490sp|Q96SI1|KCD15_HUMAN BTB/POZ domain-containing protein KCTD15 OS=Homo sapiens GN=KCTD15 PE=1 SV=1 (Range: 173-283)  ali follow..  13  6..GERIALSGEKALIEEVFPETGDVMCNSVNA---GWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCRE.... 92
7 -5.920sp|Q719H9|KCTD1_HUMAN BTB/POZ domain-containing protein KCTD1 OS=Homo sapiens GN=KCTD1 PE=1 SV=1 (Range: 147-257)  ali follow..  12  6..GERITLSGDKSLIEEVFPEIGDVMCNSVNA---GWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRE.... 92
8 -5.360tr|A8MPW8|A8MPW8_HUMAN Uncharacterized protein OS=Homo sapiens PE=4 SV=1 (Range: 171-221)  ali follow..  30  17...................................................................................LTRCLLTKEEMRT 29
9 -5.360sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 (Range: 171-221)  ali follow..  30  17...................................................................................LTRCLLTKEEMRT 29
10 -4.970sp|Q86XA9|HTR5A_HUMAN HEAT repeat-containing protein 5A OS=Homo sapiens GN=HEATR5A PE=1 SV=2 (Range: 1551-1639)  ali follow..  16  8...................................GISVEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQDLGNVLHRVILTRESPS. 71

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.