current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0PJW6|TM223_HUMAN Transmembrane protein 223 OS=Homo sapiens GN=TMEM223 PE=1 SV=1 (Range: 119-202), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSLLast
1 -64.300sp|A0PJW6|TM223_HUMAN Transmembrane protein 223 OS=Homo sapiens GN=TMEM223 PE=1 SV=1 (Range: 119-202)  ali  100  1RSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL 84
2 -16.000sp|Q96B77|TM186_HUMAN Transmembrane protein 186 OS=Homo sapiens GN=TMEM186 PE=2 SV=1 (Range: 125-213)  ali follow..  15  2RLVGILYLNESGTMLRVAHLNFWGWRQDTYCPMADVIPLTETKDRPQEMFVRIQGKQTFYVTLRYGRILDRERFTQVFG..... 83
3 -5.360sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=1 (Range: 688-755)  ali follow..  11  4..VKANLLVREANYIAEELDKRTEYKVTLQIPASSLDANRKRGSLLSEPAIQVRRK............................ 57
4 -5.200sp|Q9UPW5|CBPC1_HUMAN Cytosolic carboxypeptidase 1 OS=Homo sapiens GN=AGTPBP1 PE=1 SV=3 (Range: 277-351)  ali follow..  17  7KLGRKAFIDANGMKILYNTSQECLAVRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQL...................... 68
5 -5.120sp|Q9C086|IN80B_HUMAN INO80 complex subunit B OS=Homo sapiens GN=INO80B PE=1 SV=2 (Range: 53-138)  ali follow..  21  18....KLKIKLGGQVLSVPTFTVIPEGPRSPSPLMVVD---NEEEPMEGVPLE----QYRAWLDEDSNLSPSPLRDLS....... 86
6 -4.700sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 (Range: 680-747)  ali follow..  12  4..VKANTLVREANFLAEEMSKLTDYQVTLQIPAANLSANRKRGAIVSEPAIQVRRK............................ 57
7 -4.500sp|Q0VG06|FP100_HUMAN Fanconi anemia-associated protein of 100 kDa OS=Homo sapiens GN=FAAP100 PE=1 SV=3 (Range: 2-89)  ali follow..  18  32...AEVFLSTGSELVYV-----------YDQEGGLLTAAFRFPDQVWHLELLAPRRLLYALCARRGLY................ 85
8 -4.370sp|P51692|STA5B_HUMAN Signal transducer and activator of transcription 5B OS=Homo sapiens GN=STAT5B PE=1 SV=2 (Range: 718-787)  ali follow..  25  33............................................................VLDTDGDFDLEDTMDVARRVEELL 56
9 -4.270sp|Q6YHU6|THADA_HUMAN Thyroid adenoma-associated protein OS=Homo sapiens GN=THADA PE=1 SV=1 (Range: 1884-1953)  ali follow..  15  33RLLAFLEGKEGEDTLVLSVWDSYAESRQLTLPRTEAAC.............................................. 70
10 -4.270tr|B6ZDQ0|B6ZDQ0_HUMAN Uncharacterized protein OS=Homo sapiens GN=THADA PE=4 SV=1 (Range: 1811-1880)  ali follow..  15  33RLLAFLEGKEGEDTLVLSVWDSYAESRQLTLPRTEAAC.............................................. 70

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.