current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0PJX8|TMM82_HUMAN Transmembrane protein 82 OS=Homo sapiens GN=TMEM82 PE=2 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst LEFSLRAVSTLLSLGKGSQGAAERLQLYLLCQYSLGCGLTCGLSFLQEGAPHRTLNLLLSLGLATLLGLGARRLHRHVCRLYELHSSQRYCGVCLGLLAHAHGLPQLLGRALAIAFAVGDLAAVALINQDFLTTSEAMRFWTPLTICYTLLVIYMQEEQRQHPGLQSQVQTVLVRMGGLFVLLLTVGRWLast
1 -119.000sp|A0PJX8|TMM82_HUMAN Transmembrane protein 82 OS=Homo sapiens GN=TMEM82 PE=2 SV=2  ali  100  1LEFSLRAVSTLLSLGKGSQGAAERLQLYLLCQYSLGCGLTCGLSFLQEGAPHRTLNLLLSLGLATLLGLGARRLHRHVCRLYELHSSQRYCGVCLGLLAHAHGLPQLLGRALAIAFAVGDLAAVALINQDFLTTSEAMRFWTPLTICYTLLVIYMQEEQRQHPGLQSQVQTVLVRMGGLFVLLLTVGRW 189
2 -5.640sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2  ali   20  8..................................................................................................PQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLLCH......................................... 59
3 -5.440sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   17  1.....................................................................................................NGFLQCHIENFSTEFLTSSLMNIQHFLED-----ETVATVMPMKIQVSNTKINLKDDSPRSSTVSLEPAPVTVHIDHLVVERSDDG.. 81
4 -5.270sp|Q49AJ0|F135B_HUMAN Protein FAM135B OS=Homo sapiens GN=FAM135B PE=2 SV=2  ali   20  41.ELKAGTSIMGSHLTSAETFTLDSLKAVEVVNLSVSCTATC-LPF................................................................................................................................................ 83
5 -5.150sp|Q9UL68|MYT1L_HUMAN Myelin transcription factor 1-like protein OS=Homo sapiens GN=MYT1L PE=2 SV=3  ali   21  18....................................................................................................................................................TLTEMYTNQDRYQSPENKALLENIKQAVRGIQV........ 50
6 -5.130sp|O60284|ST18_HUMAN Suppression of tumorigenicity 18 protein OS=Homo sapiens GN=ST18 PE=1 SV=1  ali   21  18....................................................................................................................................................TLTDMYSNLERDYSPECKALLESIKQAVKGIHV........ 50
7 -4.980sp|Q5SQS8|CJ120_HUMAN Uncharacterized protein C10orf120 OS=Homo sapiens GN=C10orf120 PE=2 SV=1  ali   22  7............................................................................................................................PTCCQEDLSSASPLRIWSKFY----------RSDPRIALGKYSPLEKEILRLGGI.......... 51
8 -4.910sp|A8MWY0|K132L_HUMAN UPF0577 protein KIAA1324-like OS=Homo sapiens GN=KIAA1324L PE=2 SV=2  ali   16  49LNLHIPGFKPPTSMTGATGSELGRITF----VFETLCSADCVLYFMVDINRKSTNVVESWGGTK--QGQDNRRFINDMVKIYSITATNAVDGV................................................................................................ 160
9 -4.840sp|Q96L50|LLR1_HUMAN Leucine-rich repeat protein 1 OS=Homo sapiens GN=LRR1 PE=1 SV=2  ali   19  19TTMNLHSVAHTVVLVDNLGGTEAPIISYF-------CSLGCYVNSSDML............................................................................................................................................ 60
10 -4.800sp|Q13591|SEM5A_HUMAN Semaphorin-5A OS=Homo sapiens GN=SEMA5A PE=1 SV=3  ali   13  16..................................................................................................VSPAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTD................................ 74

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.