current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=2 SV=1 (Range: 106-243), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst PAAVPSAPAFSCSDLLNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFLast
1 -108.000sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=2 SV=1 (Range: 106-243)  ali  100  1PAAVPSAPAFSCSDLLNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHPVASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAF 138
2 -54.000sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 (Range: 65-221)  ali follow..  26  57.....CGASGLCK--TNCGVCCKAELGLAPSALPAGRVIKPQVINQAGLPASGSLYYFNYLDSTAYPPSLLSGHLFPSGLLNAALAAHPKLFLLENAKLAGL.................................... 157
3 -5.930sp|Q8NHX9|TPC2_HUMAN Two pore calcium channel protein 2 OS=Homo sapiens GN=TPCN2 PE=2 SV=2 (Range: 316-402)  ali follow..  20  9..................................QTSLFRRRLGTRAAFEVLSSM---VGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVR-----------SYGSVLLSAEEFQKLFNE........... 87
4 -5.350tr|E9PG74|E9PG74_HUMAN Uncharacterized protein OS=Homo sapiens GN=TPCN2 PE=4 SV=2 (Range: 71-194)  ali follow..  17  13..................................QTSLFRRRLGTRAAFEVLSSM---VGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHKQAMMEKVRLDRSVVKEHPPRPEYQSPFLQSAQFLFGHY.......... 121
5 -5.220sp|Q0P6D6|CCD15_HUMAN Coiled-coil domain-containing protein 15 OS=Homo sapiens GN=CCDC15 PE=2 SV=2 (Range: 1-74)  ali follow..  22  30..........................................................................................AVLAERNEAIVPVGAWVEPASPGSSEIPAYTSAYLIEEELKEQLR... 74
6 -4.940sp|Q8NE09|RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens GN=RGS22 PE=2 SV=3 (Range: 285-354)  ali follow..  10  1..................................................................................TPSQALLRVYLEKKQDVDESLTMHFST----EEFLSSYIYFILRGAIQQIVGK... 50
7 -4.800sp|Q8N8M0|CG052_HUMAN Putative N-acetyltransferase C7orf52 OS=Homo sapiens GN=C7orf52 PE=2 SV=2 (Range: 161-369)  ali follow..  13  2........................DDQLGPRELKKYRLITKQGILLVRFNASALLAGLGARLAALRTSGTFS--PLPTEAVSEAGGDVARLLLSPSVQRDVLPGGTIIQDWQPYRPSESNLRLLAAKGLEWRVDSRA. 112
8 -4.730sp|Q5T011|SZT2_HUMAN Protein SZT2 OS=Homo sapiens GN=SZT2 PE=2 SV=3 (Range: 2648-2731)  ali follow..  17  16..............TYNWAPDLGAALGRALVRLVQWQNARAHLIFCLLSQKLGLFHHYGQLDFPVRDEKEPNPFLLPTMEVET....................................................... 84
9 -4.730sp|Q8N957|ANKF1_HUMAN Ankyrin repeat and fibronectin type-III domain-containing protein 1 OS=Homo sapiens GN=ANKFN1 PE=2 SV=2 (Range: 679-763)  ali follow..  19  3............YELQMAVKALLQQINIPLHQARNFRLYTQEVLEMG--HNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELGIVACFT......................................... 85
10 -4.700sp|Q8N961|ABTB2_HUMAN Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Homo sapiens GN=ABTB2 PE=2 SV=1 (Range: 192-309)  ali follow..  10  6..................................................ALHTLYYFLRCPQ-NNERPFMLLPPLMEWMRVAITYAEHRR-IRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDARAATEKFNQDLGF 115

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.