current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|A0ZSE6|CC50C_HUMAN Cell cycle control protein 50C OS=Homo sapiens GN=TMEM30C PE=2 SV=2 (Range: 58-113), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .
# Score Template Links and tools%idFirst RSTQEIEINYTRICANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLHLast
1 -51.200sp|A0ZSE6|CC50C_HUMAN Cell cycle control protein 50C OS=Homo sapiens GN=TMEM30C PE=2 SV=2 (Range: 58-113)  ali  100  1RSTQEIEINYTRICANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH 56
2 -5.790sp|Q9NQV5|PRD11_HUMAN PR domain-containing protein 11 OS=Homo sapiens GN=PRDM11 PE=1 SV=2 (Range: 437-511)  ali follow..  22  2......ELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPE............... 36
3 -5.400tr|E9PHF9|E9PHF9_HUMAN Uncharacterized protein OS=Homo sapiens GN=POLE PE=4 SV=1 (Range: 173-256)  ali follow..  26  18............VCLKCRGVKET--SMPVYCSCAGDFALT................ 43
4 -5.150sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 (Range: 370-492)  ali follow..  26  94......ELVLSTTLDGGRKIPETTMNFDPDCFLNNP.................... 123
5 -4.520sp|Q9BX69|CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens GN=CARD6 PE=1 SV=2 (Range: 371-427)  ali follow..  1QTINPLDVLCATMLCSDSSLQRQVMSNMYQCQFALPLLLPD............... 41
6 -4.250sp|Q8NFM7|I17RD_HUMAN Interleukin-17 receptor D OS=Homo sapiens GN=IL17RD PE=1 SV=3 (Range: 536-601)  ali follow..  25  8.........YVAICNMHQFIDEEPDWFEKQFVPFHPPPLRYREPVLEKFDSGLVLN 54
7 -4.220sp|Q7Z401|MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens GN=DENND4A PE=1 SV=2 (Range: 1439-1498)  ali follow..  30  6....EVLISSCSRCRTCDCLTADDSNLNTTCPCGNIF................... 49
8 -4.190sp|Q8N8Q8|COX18_HUMAN Mitochondrial inner membrane protein COX18 OS=Homo sapiens GN=COX18 PE=2 SV=1 (Range: 1-81)  ali follow..  19  50......................HANGWYEALAASSPVRVAEEVLLGVHAATGL... 80
9 -4.080sp|Q4ZG55|GREB1_HUMAN Protein GREB1 OS=Homo sapiens GN=GREB1 PE=2 SV=1 (Range: 1454-1518)  ali follow..  20  3RLSKYAAYNTYHHCEQCHQYMGFHPRYQLYESTLHAFAFSYSMLGEEIQ....... 51
10 -4.070sp|Q5VZ89|DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens GN=DENND4C PE=1 SV=2 (Range: 1247-1303)  ali follow..  27  4....EVLMSSCSQCRACGALTADDSNLNTACPCKSNF................... 47

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.