current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: tr|E7ETP3|E7ETP3_HUMAN Uncharacterized protein OS=Homo sapiens GN=LHX3 PE=3 SV=1 (Range: 328-397), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst PPWPPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQFLast
1 -53.200tr|E7ETP3|E7ETP3_HUMAN Uncharacterized protein OS=Homo sapiens GN=LHX3 PE=3 SV=1 (Range: 328-397)  ali  100  1PPWPPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF 70
2 -6.900sp|Q6NSI4|CX057_HUMAN Uncharacterized protein CXorf57 OS=Homo sapiens GN=CXorf57 PE=1 SV=2 (Range: 469-558)  ali follow..  20  18..............................IQWIRTKSDSGEQKNMVIGGYYPYPPVPET.......... 47
3 -6.750sp|Q6NUQ4|TM214_HUMAN Transmembrane protein 214 OS=Homo sapiens GN=TMEM214 PE=1 SV=2 (Range: 115-216)  ali follow..  22  5......................................DVADLQKELDKSQSVFSGNPSIWLKDL..... 31
4 -5.930sp|Q68CZ2|TENS3_HUMAN Tensin-3 OS=Homo sapiens GN=TNS3 PE=1 SV=2 (Range: 774-862)  ali follow..  41  64...........................................SKESMCSTPAFPVSPET.......... 80
5 -5.790sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3 (Range: 2601-2677)  ali follow..  11  4.......ARLLVGNDDVHIIARSDDELLDDF-------HDQSTATSQAGTLSSIPTALTRWTEE...... 54
6 -5.520sp|Q8IWG1|WDR63_HUMAN WD repeat-containing protein 63 OS=Homo sapiens GN=WDR63 PE=2 SV=1 (Range: 150-338)  ali follow..  15  1..................................................YIYKPPVSKPWVSLGSEKEI 20
7 -5.470sp|Q6ZVL6|CK041_HUMAN UPF0606 protein C11orf41 OS=Homo sapiens GN=C11orf41 PE=2 SV=2 (Range: 1688-1765)  ali follow..  19  13.......SALNYSGNTVPAVFAIPAANRPGFTGYFIPTPPSSYRNQAWMSYAGENELPSQWADSVPLPGY 75
8 -5.350sp|Q3C1V9|YK041_HUMAN Putative uncharacterized protein ENSP00000334305 OS=Homo sapiens PE=5 SV=2 (Range: 470-532)  ali follow..  21  6..........................................CGIAEAVGLPSIPVHPIGY......... 24
9 -5.340sp|Q4VC12|ZMY17_HUMAN Zinc finger MYND domain-containing protein 17 OS=Homo sapiens GN=ZMYND17 PE=2 SV=2 (Range: 256-405)  ali follow..  21  91......................................HHPDLVAAFHPGFHSSPDLMEAWLPTLL.... 118
10 -5.180sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=2 SV=2 (Range: 1-121)  ali follow..  23  7PAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHTLGYPNVHEITRSTITEMAAAQ. 76

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.