current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|O60284|ST18_HUMAN Suppression of tumorigenicity 18 protein OS=Homo sapiens GN=ST18 PE=1 SV=1 (Range: 998-1047), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst LPQMGPISEQNFEAYVNTLTDMYSNLERDYSPECKALLESIKQAVKGIHVLast
1 -46.500sp|O60284|ST18_HUMAN Suppression of tumorigenicity 18 protein OS=Homo sapiens GN=ST18 PE=1 SV=1 (Range: 998-1047)  ali  100  1LPQMGPISEQNFEAYVNTLTDMYSNLERDYSPECKALLESIKQAVKGIHV 50
2 -46.500sp|Q9UL68|MYT1L_HUMAN Myelin transcription factor 1-like protein OS=Homo sapiens GN=MYT1L PE=2 SV=3 (Range: 1137-1186)  ali follow..  70  1LPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV 50
3 -6.950sp|Q9NQC3|RTN4_HUMAN Reticulon-4 OS=Homo sapiens GN=RTN4 PE=1 SV=2 (Range: 224-356)  ali follow..  20  12LPSLSPLSAASFKEHLGNLSTVLPTEGTLQENVSEASKEVSEKA...... 57
4 -5.680sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 (Range: 1-124)  ali follow..  19  84.............LKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQ. 119
5 -5.480sp|Q9UL42|PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens GN=PNMA2 PE=1 SV=2 (Range: 142-206)  ali follow..  15  34.....APEEESFEVWLEQATEIVKEWPVTEAEKKRWL............. 65
6 -5.370sp|Q96JG6|CC132_HUMAN Coiled-coil domain-containing protein 132 OS=Homo sapiens GN=CCDC132 PE=1 SV=3 (Range: 607-684)  ali follow..  12  35.........QLFDYYLYAIYTFFGRNDSLESTGLGLSSSRLRTTLNRIQ. 74
7 -5.140sp|A0PJX8|TMM82_HUMAN Transmembrane protein 82 OS=Homo sapiens GN=TMEM82 PE=2 SV=2 (Range: 97-285)  ali follow..  21  149.................TLLVIYMQEEQRQHPGLQSQVQTVLVRMGGLFV 181
8 -4.950sp|Q6ZU11|YD002_HUMAN Uncharacterized protein FLJ44066 OS=Homo sapiens PE=1 SV=1 (Range: 67-168)  ali follow..  10  24FPSGQKIKSAYLPQRQIHIPAVFQSPAHYKQTFTSCLIEHLNILLFGL.. 71
9 -4.750sp|Q5T4S7|UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens GN=UBR4 PE=1 SV=1 (Range: 2472-2594)  ali follow..  19  58..................LASLHTSRSAYHSHKDQALLSKAVQCLNTSS. 88
10 -4.740tr|C9JMU6|C9JMU6_HUMAN Uncharacterized protein OS=Homo sapiens GN=PPP2R3B PE=4 SV=1 (Range: 101-169)  ali follow..  15  2FPRGRPQDSVNVDAVISKIESTFARF-----PHERATMDDMGLVAKACGC 46

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.