current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|O60725|ICMT_HUMAN Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens GN=ICMT PE=1 SV=1 (Range: 89-163), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst SWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLast
1 -55.100sp|O60725|ICMT_HUMAN Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens GN=ICMT PE=1 SV=1 (Range: 89-163)  ali  100  1SWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTG 75
2 -6.060sp|Q9Y6X2|PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens GN=PIAS3 PE=1 SV=2 (Range: 500-572)  ali follow..  22  8.......FLSSLPLHEYPPAFPLG-ADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHF.... 70
3 -5.510sp|Q6P2C0|WDR93_HUMAN WD repeat-containing protein 93 OS=Homo sapiens GN=WDR93 PE=2 SV=1 (Range: 101-233)  ali follow..  70......LFYFYKEGLYLVKAINEVDDTSKQTTCIKMEISQGGDFAAFLLQGAGDIWLDVYKLP............ 126
4 -5.390sp|Q16549|PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 OS=Homo sapiens GN=PCSK7 PE=1 SV=2 (Range: 621-706)  ali follow..  12  51....VGCFTVFWTVYYMLEVYLSQRNVASNQVCRS........................................ 81
5 -5.270sp|Q5T6C5|AT7L2_HUMAN Ataxin-7-like protein 2 OS=Homo sapiens GN=ATXN7L2 PE=2 SV=1 (Range: 390-449)  ali follow..  20  17...............RPPRPQAFCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLST................ 60
6 -5.180sp|Q8NEG5|ZSWM2_HUMAN E3 ubiquitin-protein ligase ZSWIM2 OS=Homo sapiens GN=ZSWIM2 PE=1 SV=2 (Range: 390-531)  ali follow..  13  81.................LCSIKLDNSNSKKLTYDYKISQHFPRYLQDLPTVSFGKIPSQTLLPPIVHKNIVCPTA 138
7 -5.020tr|Q9BTQ8|Q9BTQ8_HUMAN ATXN7L1 protein OS=Homo sapiens GN=ATXN7L1 PE=2 SV=2 (Range: 1-60)  ali follow..  15  17...............HHPRPLAFCSFGSRLMGRGYYVFDRRWDRFRFALNSMVEKHLNS................ 60
8 -4.960sp|O15265|ATX7_HUMAN Ataxin-7 OS=Homo sapiens GN=ATXN7 PE=1 SV=1 (Range: 513-562)  ali follow..  12  2...............HHPQPASFCTFGSRQIGRGYYVFDSRWNRLRCALNLMVEKHLNAQLWKK........... 50
9 -4.930sp|Q5JVX7|CA141_HUMAN Uncharacterized protein C1orf141 OS=Homo sapiens GN=C1orf141 PE=2 SV=1 (Range: 167-259)  ali follow..  25  43............IIFHDTEYVRMLLLTKNRFS--SHPLENENIYPHKRTNFILE..................... 82
10 -4.840sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens GN=PSMD1 PE=1 SV=2 (Range: 1-266)  ali follow..  15  58...QFAALVASKVFYHLGAFEESLNYALGA---DLFNVNDNSEYVETIIAKCIDHYTK................. 110

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.