current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|O75131|CPNE3_HUMAN Copine-3 OS=Homo sapiens GN=CPNE3 PE=1 SV=1, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst GADFSAMEFLDGDGGSLRSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQLast
1 -55.700sp|O75131|CPNE3_HUMAN Copine-3 OS=Homo sapiens GN=CPNE3 PE=1 SV=1  ali  100  1GADFSAMEFLDGDGGSLRSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ 80
2 -52.200sp|Q96FN4|CPNE2_HUMAN Copine-2 OS=Homo sapiens GN=CPNE2 PE=1 SV=3  ali   62  1NADFAAMEFLDGDSRMLRSHTGEEAARDIVQFVPFREFRNAAKETLAKAVLAELPQQVVQYFKHKNLPPTNSEPA..... 75
3 -50.600sp|Q9UBL6|CPNE7_HUMAN Copine-7 OS=Homo sapiens GN=CPNE7 PE=2 SV=1  ali   53  1NADFTDMQVLDGDDGVLRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEAS 80
4 -47.700sp|Q99829|CPNE1_HUMAN Copine-1 OS=Homo sapiens GN=CPNE1 PE=1 SV=1  ali   65  1GADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYRRFQNAPREALAQTVLAEVPTQLVSYFRAQG.............. 66
5 -40.700sp|Q9HCH3|CPNE5_HUMAN Copine-5 OS=Homo sapiens GN=CPNE5 PE=1 SV=2  ali   49  1QAEFDAMVELDGDDVRI-SSRGKLAERDIVQFVPFRDYVDRSMARLARDVLAEIPDQLVSYMKAQ............... 70
6 -40.000sp|Q86YQ8|CPNE8_HUMAN Copine-8 OS=Homo sapiens GN=CPNE8 PE=1 SV=2  ali   47  2.AEFDAMVELDGDDVRV-SSRGKYAERDIVQFVPFRDYIDRSMARLAKDVLAEIPEQFLSYMRARG.............. 71
7 -39.600sp|Q8IYJ1|CPNE9_HUMAN Copine-9 OS=Homo sapiens GN=CPNE9 PE=1 SV=3  ali   50  2.AMFEAMEELDGDDVRV-SSRGRYAERDIVQFVPFRDYVDRSMARLAKDVLAEIPEQLLSYMRTRD.............. 71
8 -6.060sp|Q14699|RFTN1_HUMAN Raftlin OS=Homo sapiens GN=RFTN1 PE=1 SV=4  ali   10  6...............QVETKIDVSYEYRFLEFTTLSAAELPGSSAVRLASLRDLPAQLLELYQQ................ 54
9 -6.010sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1  ali   19  12....SVLECLDSVGQKLLFLTRETDAGELPSSRNCQTIKCLSNKEVLEQARVEIP......................... 62
10 -5.960tr|B0UZT8|B0UZT8_HUMAN Chromosome 6 open reading frame 10 (Fragment) OS=Homo sapiens GN=C6orf10 PE=4 SV=1  ali   18  12QGSMSSIKCLQTTEELPSRTAG-----AMMQFTA-----ATGPIKLSQKTIVQTPGPIVQY................... 66

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Flexible structure alignment by chaining aligned fragment pairs allowing twists. Bioinformatics. 2003 Oct;19 Suppl 2:II246-II255.