current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst SILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQATFEVLDFITHLYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSCYSCCPRLASVLLYSDYGIGEVPVEPLDVPLLast
1 -80.900sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4  ali  100  1SILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQATFEVLDFITHLYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSCYSCCPRLASVLLYSDYGIGEVPVEPLDVPL 147
2 -6.270sp|Q5JSL3|DOC11_HUMAN Dedicator of cytokinesis protein 11 OS=Homo sapiens GN=DOCK11 PE=1 SV=2  ali   13  107SKISSTRNEASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFANSDRPMKATAPAEVKDLTKRIRTVLM...................................................... 200
3 -6.120sp|Q9BZ29|DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens GN=DOCK9 PE=1 SV=2  ali   15  104SKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCANSDRLIKHTSSSDVKDLTKRIRTVLM...................................................... 197
4 -6.070sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali   11  31...........PNLYIQLNG-LTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKL-EHLDIRVSFPLEKRERAELHRPQALVFSASG---MIATNTRHAPHCSCSDLQSLFRGFAAA............................... 144
5 -6.010sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   33...........PNLYSQLNA-LQFTVDERSILWLNQFLLDLKQSLNQFMAVYKL-EHVDVRFVIPSEVKSECHQDQPRAISIQSSE---MIATNTRHCPNCRHSDLEALFQDFKDC............................... 146
6 -5.890sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2  ali   12  23IMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVYREQHRSTLGFVRSIALTPQVCGAL-ITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLWDKTERARDMKCLVEKLFD.................................... 141
7 -5.600sp|Q96BY6|DOC10_HUMAN Dedicator of cytokinesis protein 10 OS=Homo sapiens GN=DOCK10 PE=1 SV=3  ali   17  104HRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQLIKAVSQLIADAGIGGSRFQH-SLAITNNFANDKQMKNSNFPAEVKDLTKRIRTVLM...................................................... 196
8 -5.550sp|Q9UK85|DKKL1_HUMAN Dickkopf-like protein 1 OS=Homo sapiens GN=DKKL1 PE=1 SV=1  ali   14  5........................................FLKGNLLRGIDSLFSAPMDFRGLPGNYHKEENQEHQLGNNTLSSHLQIDKM-TDNKTGEVLISENVVASIQP................................... 75
9 -5.520sp|Q52LD8|RFTN2_HUMAN Raftlin-2 OS=Homo sapiens GN=RFTN2 PE=1 SV=3  ali   12...........EFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYYLKGYIVGAIHYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAAKELIEK....................................... 125
10 -5.430sp|Q9P2N6|K1310_HUMAN Uncharacterized protein KIAA1310 OS=Homo sapiens GN=KIAA1310 PE=1 SV=2  ali   55KLFNKILKALQSDRLARLANEGACNEPVLRRVAVDKCARRVRQALASVWLHTTLVETLSLPMLAAYLD............................................................................... 130

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.