current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q13591|SEM5A_HUMAN Semaphorin-5A OS=Homo sapiens GN=SEMA5A PE=1 SV=3 (Range: 994-1074), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst QRYQQQSHDATVIHPVSPAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEYLast
1 -73.400sp|Q13591|SEM5A_HUMAN Semaphorin-5A OS=Homo sapiens GN=SEMA5A PE=1 SV=3 (Range: 994-1074)  ali  100  1QRYQQQSHDATVIHPVSPAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY 81
2 -8.710tr|C9J415|C9J415_HUMAN Uncharacterized protein OS=Homo sapiens GN=ATG7 PE=4 SV=1 (Range: 1-152)  ali follow..  16  89.................................NTNTLESFKTADKKLLLEQAANEIWESIKSGTAFLLLTFAIEALECAY 145
3 -6.260sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 (Range: 206-263)  ali follow..  17  5.....KEHKPLVLRPVYIGTVQYKIKMFNSVKEELIPLQFYGTLPKGYVIKE............................. 51
4 -6.200tr|B2RTR6|B2RTR6_HUMAN PCNX protein OS=Homo sapiens GN=PCNX PE=2 SV=1 (Range: 2132-2230)  ali follow..  35  47....QEGMEGHVIHRWVPCSRDPGTRSHIDKADKYVTV........................................... 87
5 -6.200sp|Q96RV3|PCX1_HUMAN Pecanex-like protein 1 OS=Homo sapiens GN=PCNX PE=2 SV=2 (Range: 2243-2341)  ali follow..  35  47....QEGMEGHVIHRWVPCSRDPGTRSHIDKADKYVTV........................................... 87
6 -6.110sp|Q6KC79|NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens GN=NIPBL PE=1 SV=2 (Range: 2557-2631)  ali follow..  31  6.............................SKIQKYSPSESAKVYDKA--INRKTGVHFHP..................... 34
7 -5.930sp|O95352|ATG7_HUMAN Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens GN=ATG7 PE=1 SV=1 (Range: 1-350)  ali follow..  23  90..................................TNTLESFKTADKKLLLEQAANEIWESIKSGTAFLLLTFADLKKYHFY 145
8 -5.900tr|F5H146|F5H146_HUMAN Uncharacterized protein OS=Homo sapiens GN=STXBP2 PE=4 SV=1 (Range: 336-398)  ali follow..  12  21...KQTLRLGAVAHTCNPSAVGGQGRRITWGQEFETSLGTEQD...................................... 60
9 -5.160sp|Q9P0W8|SPAT7_HUMAN Spermatogenesis-associated protein 7 OS=Homo sapiens GN=SPATA7 PE=2 SV=3 (Range: 1-72)  ali follow..  11  24.........................GHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKILSAKAAVDC........... 68
10 -5.120sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 (Range: 1-61)  ali follow..  28  20YPFIFSASDTPVIFSISAAPM............................................................ 40

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.