current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst ELALDLANFQADVELGALDRLAALLRLATVPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPWAGQAVRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGKPLast
1 -90.200sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3  ali  100  1ELALDLANFQADVELGALDRLAALLRLATVPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPWAGQAVRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGKP 129
2 -7.760tr|A8K3Q5|A8K3Q5_HUMAN Uncharacterized protein OS=Homo sapiens GN=IL17RC PE=4 SV=1  ali   27  35.........................................SHPLLHTQTVTYSACLGTSCLLRAPCWRLRTCRQSW.................................................... 70
3 -6.610sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   34NLYSQLNALQFTVDERSILWLNQFLLD--KQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQD------QPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTP 157
4 -6.260sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali   32NLYIQLNGLTFTMDPVSLLWGNLFCLD--YRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELH------RPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYD. 152
5 -5.380sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens GN=KIF24 PE=1 SV=2  ali   14  58....YLSAILGDCDIPIIQRISHVS........................................................................................................ 78
6 -5.310sp|A2VDJ0|T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens GN=KIAA0922 PE=1 SV=2  ali   16  164..SLSLDQSTWNVDSELANKLKKYKNGDVCKRNVLGTTRFAHLKKSKESESFVFFLPRLGLMLNFSATALRSRMIKYFVQNPSSWPVSLQLPKPEALVHLLHRWFGTDMQMINFTTGE........... 294
7 -5.250sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2  ali   114.IDVQAGSLTAKVTAPQLACLLEWGQTFVFHVVCREYELERPKSV--------IICQHGIDRRFCESKLSCIPGPCPTSDDLKYTMIRLAVDGADIYIVEHGCATNIKMGAIRVANCNLHN........ 225
8 -5.140sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2  ali   15  119NVLWKMCGIDVHMDPNIGKRLNALGN....................................................................................................... 144
9 -5.140sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   13  4.LQCHIENFSTEFLTSSLMNIQHFLE----------------DETVATVMPMKIQVSNTKINLKDDSPRSSTVSLEPAPVTVHIDHLVVE....................................... 76
10 -5.050sp|Q5GH76|XKR4_HUMAN XK-related protein 4 OS=Homo sapiens GN=XKR4 PE=1 SV=1  ali   15  7.....................................QVRPTAPSTPSSRPPRIEESVIKIDLRYPAWERH-----VLDRSLRKAILAFECSPSPPRLQYKDDALIQERLEYETT.............. 82

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.