current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q5SR76|CJ093_HUMAN TPR repeat-containing protein C10orf93 OS=Homo sapiens GN=C10orf93 PE=2 SV=2 (Range: 1105-1248), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst DDLALRAALYGLLFHSHADQDDWEGGLKVLDEAVQVLPRTAHRLLIFKHMVIVKAKLGQNFSMEIQKFKAESEDYLARMWHRLALNSPSVSGELACYNNAIQALQKPEMEWQKVEYLMEFGQWLHHRHFPLEDVVFHLRWAVEILast
1 -76.000sp|Q5SR76|CJ093_HUMAN TPR repeat-containing protein C10orf93 OS=Homo sapiens GN=C10orf93 PE=2 SV=2 (Range: 1105-1248)  ali  100  1DDLALRAALYGLLFHSHADQDDWEGGLKVLDEAVQVLPRTAHRLLIFKHMVIVKAKLGQNFSMEIQKFKAESEDYLARMWHRLALNSPSVSGELACYNNAIQALQKPEMEWQKVEYLMEFGQWLHHRHFPLEDVVFHLRWAVEI 144
2 -8.190sp|Q14674|ESPL1_HUMAN Separin OS=Homo sapiens GN=ESPL1 PE=1 SV=3 (Range: 717-845)  ali follow..  13  9EDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTK-----------------------------QAPAVRCLQQTAASLQILAQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQ-LLLTLGCPSYAQLHLEEAASS 126
3 -6.110tr|E9PIN2|E9PIN2_HUMAN Uncharacterized protein OS=Homo sapiens GN=PDE4DIP PE=4 SV=1 (Range: 1-82)  ali follow..  14  11.............................AEDDGEMVPRTSHTAAF------------------LSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKVSHV........................... 80
4 -5.720tr|E9PRJ6|E9PRJ6_HUMAN Uncharacterized protein OS=Homo sapiens GN=PDE4DIP PE=4 SV=1 (Range: 1-107)  ali follow..  14  11.............................AEDDGEMVPRTSHTAAF------------------LSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKTWRVCMVIKRLLKTKPPNSCVV......... 98
5 -5.480sp|Q15573|TAF1A_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit A OS=Homo sapiens GN=TAF1A PE=1 SV=1 (Range: 1-150)  ali follow..  13  48KDFAQTTSACLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIW--KLGSEI---------------------LFYHPKSNMESFNTFANRMKNIGVMN----YLKISLQHALYLLHHG................ 148
6 -5.330tr|F8WDN4|F8WDN4_HUMAN Uncharacterized protein OS=Homo sapiens GN=TTC21A PE=4 SV=1 (Range: 1-91)  ali follow..  1..MSSNDSSLMAGIIYYSQEKYFHHVQQAAAVGLEKFSNDPVLKFFKAYGVLKEEHIQDAISDLESIRHHPDVSLCSTMALIYAHKRCEIIGE................................................... 91
7 -5.320sp|P32780|TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens GN=GTF2H1 PE=1 SV=1 (Range: 456-548)  ali follow..  12  1...........................................................DIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQV-----TKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYN. 79
8 -5.250tr|E2QRG0|E2QRG0_HUMAN Uncharacterized protein OS=Homo sapiens GN=MAP3K6 PE=4 SV=1 (Range: 1-104)  ali follow..  1.............................................................MVQLSLLRAETDRLREILAGKEREYQALVQRALQRLNEEARTYVLAPEPPTALSTDQGLVQWLQELNVDSGTIQMGRDGMPHL 83
9 -5.060tr|C9JNM7|C9JNM7_HUMAN Uncharacterized protein OS=Homo sapiens GN=NPHP1 PE=4 SV=1 (Range: 286-465)  ali follow..  12  49.................................CKMIPLPGMSIQVLSRHVRLCLFDGNKVLSNIHTVRATWQPKKPKTWTFSPQVTRILPCLLDG-----DCFIRSNSASPDLGILFELG....................... 131
10 -5.060sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 293-448)  ali follow..  27...KLDCNIEIQNIAIELTKPQYLSMIDLLESVDYMVRNAPYRKYKPYLPLHTNGRRWWKYAIDSVLEVHIRRYTQMWSWSNIKKHRQLLKSYKIAYKNKLTQ-EEIQKEIQDLEKTLDVFNIILARQQA.............. 156

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.