current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst LHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWALast
1 -112.000sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali  100  1LHNLPTQVSAIHIEFTEYYFPDNQELPVPCPNLYIQLNGLTFTMDPVSLLWGNLFCLDLYRSLEQFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAAAEFFHSNYDHFPKVPGGFSLLHMLFLHHAFQMDSCLPQPNTLPPQRPKASWDLWSVHFTQISLDFEGTENFKGHTLNFVAPFPLSIWA 231
2 -88.500sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   49  3SLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILWLNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRHAH.......................................................... 175
3 -8.210sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1  ali   15  1.............EMLYERNPAHSHFE----RLNVSTRPLNIIYNPQAIKKVADFFYQTKAEIRQTLDRLLVGDFIEESKRWTVRLDISAPQVIFP----DDFKFKNPVLVVVDLGRMLL............................................................................................................... 132
4 -6.630sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   1................................................................................RLLMDINLKAPVIIIPQSSVSPN------AVIADLGLIRVENKFSLVPMEHYSLPPVIDKMN......................................................................................... 56
5 -6.260sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3  ali   1...............................ELALDLANFQADVELGALDRLAALLRL-VPAEPPAGLLTEPLPAMEQQTVFRLSAPRATLRLRFPIADLRPEPDPRAEQLRLELSEPQFRSELSSGPGPPVPTHLELTCSDLHGIYEDGGK............................................................................... 128
6 -6.250sp|Q6STE5|SMRD3_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Homo sapiens GN=SMARCD3 PE=1 SV=1  ali   10  1..............MADKILPQRIRELVPESQAYMDLLAFERKLDQTI-----------------MRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKDLY..................................................................................... 115
7 -6.200sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1  ali   10  1.................................................................................VSINIDLKAPVIVIPQSSISTN------AVVVDLGLIRVHNQFSLVSDEDYLNPPVIDRMD......................................................................................... 55
8 -6.060sp|Q13057|COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4  ali   11  12..............................HTLYVHLQPMSLEGPAQPQSSPVQATFEVLDFITHLYAGADV-------RHLDVR-------ILLTNIRTKSTFLPPLPTSVQNLAHVVLTDFQTLDGSQYNPVKQQLVRYATS....................................................................................... 116
9 -5.980sp|Q8TAP6|CEP76_HUMAN Centrosomal protein of 76 kDa OS=Homo sapiens GN=CEP76 PE=1 SV=1  ali   10  43......................TIGCVFNHQMFLGNCAVETCVFDLDESKWKPMSEEAIKSATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWEDQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPDGHTFKGFP--------IHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVR-------------------VFTYPCAVWI 237
10 -5.590sp|Q96GM5|SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens GN=SMARCD1 PE=1 SV=2  ali   10  1....................PQRIRELVPESQAYMDLLAFERKLDQTI-----------------MRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKS........................................................................................ 106

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.