current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q6NUS6|TECT3_HUMAN Tectonic-3 OS=Homo sapiens GN=TCTN3 PE=2 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst QTLHGRPRPEYVAIFGNADPAQKGGWTRILNRHCSISAINCTSCCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSLTTLVNFVDITQKPQPPRGQPKMDWKWPFDFFPFKVAFSRLast
1 -86.700sp|Q6NUS6|TECT3_HUMAN Tectonic-3 OS=Homo sapiens GN=TCTN3 PE=2 SV=2  ali  100  1QTLHGRPRPEYVAIFGNADPAQKGGWTRILNRHCSISAINCTSCCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSLTTLVNFVDITQKPQPPRGQPKMDWKWPFDFFPFKVAFSR 132
2 -85.400tr|B4DR81|B4DR81_HUMAN Uncharacterized protein OS=Homo sapiens GN=TCTN3 PE=2 SV=1  ali   100  1.TLHGRPRPEYVAIFGNADPAQKGGWTRILNRHCSISAINCTSCCLIPVSLEIQVLWAYVGLLSNPQAHVSGVRFLYQCQSIQDSQQVTEVSLTTLVNFVDITQKPQPPRGQPKMDWKWPFDFFPFKVAFSR 131
3 -60.800tr|C9J1H5|C9J1H5_HUMAN Uncharacterized protein OS=Homo sapiens GN=TCTN1 PE=4 SV=1  ali   29  24SLLWGQGFPDYVAPFGNSQAQDMLDWVPIHFITQSFNHFVLQDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPEANNERTILISTAVTFVDVSAPAEAGFRAPAINARLPFNFFPFV..... 156
4 -57.900sp|Q96GX1|TECT2_HUMAN Tectonic-2 OS=Homo sapiens GN=TCTN2 PE=2 SV=1  ali   19  7ERLDSLIQATHVAMRGNSDYADLSDWLEIIRVDAPDPSSVNGMCLDIPAHLSIRILISDAGAVEGTQQEILGVETRFSSVNWQYQCKADLLPISASVQFIKIPAQLPHPLTRCNRNEVCWPQLYPWTQYYQ. 161
5 -41.900tr|F8VRI9|F8VRI9_HUMAN Uncharacterized protein OS=Homo sapiens GN=TCTN1 PE=4 SV=1  ali   24  1......................MLDWVPIHFITQSFNRKD---SCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPENAQMNIHVKFENCTFGEIKFYIQ......................... 86
6 -6.070tr|C9JLE0|C9JLE0_HUMAN Uncharacterized protein OS=Homo sapiens GN=MBNL2 PE=4 SV=1  ali   13  40.......................................................................GTSAVFNPSVLHYQQALTSAQLQQHAAFIPTVPMMHSATSATVSAATTPATSVPFAATAT. 99
7 -6.050sp|P42704|LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3  ali   10  14.....................................................SFFLQHCVTMNTPVEKLTDYCKKLKEVQMHSFPLQFTLHCALLANKTDLAKALMKAVKEEGFPIR-PHYFWPLLVGRR. 90
8 -5.820sp|Q96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens GN=SECISBP2 PE=1 SV=2  ali   15  10......................................................................................ESEGIKLSADVKFVPRFAGLNVAWLESSEACVFPSTYYPFVQEPP. 58
9 -5.560sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2  ali   10  9.........RAVSCFQKISVQTTQIVISMETVPHTSKPCLLASLSNLNGSLSVKATQKVPGIILGSSFLLSINDFLLKTERSRILIGPCCATANLEAKWCKHSGNPGPEQSIPKISIDLRGGLLQVFWGQEH 134
10 -5.470sp|Q6P4Q7|CNNM4_HUMAN Metal transporter CNNM4 OS=Homo sapiens GN=CNNM4 PE=1 SV=3  ali   13  8.......STVNLRLYGYSLGNISSNLISFTEVDDAETLHKSTSCLELTKDLVVQ---QLVNVSRGNTSGVLVVLTK........................................................ 73

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.