current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q6PIJ6|FBX38_HUMAN F-box only protein 38 OS=Homo sapiens GN=FBXO38 PE=1 SV=3 (Range: 913-1188), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst EDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEEDLKKYPKYPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYILast
1 -94.500sp|Q6PIJ6|FBX38_HUMAN F-box only protein 38 OS=Homo sapiens GN=FBXO38 PE=1 SV=3 (Range: 913-1188)  ali  100  1EDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLKHLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFSGPYPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEEDLKKYPKYPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQLSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI 276
2 -6.300sp|Q8IWA5|CTL2_HUMAN Choline transporter-like protein 2 OS=Homo sapiens GN=SLC44A2 PE=1 SV=3 (Range: 95-204)  ali follow..  10  1...........CASPLVLLEFQCPTPQICVEKCPDRSSRDFEYYKQFCVPGFKNNKGVAELQDGDCPAV............................................................................................................................................................................................................... 67
3 -5.900sp|A7MBM2|DISP2_HUMAN Protein dispatched homolog 2 OS=Homo sapiens GN=DISP2 PE=2 SV=2 (Range: 272-483)  ali follow..  21MSTSSGSL-WNLHAIHSM----CRMEQDQIRSHTSFGALNRSSCLDTTQADAARTLAL----LRTCALY............................................................................................................................................................................................................... 103
4 -5.870sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 (Range: 532-781)  ali follow..  190.EGRVKDINSS-TKTRSIGVGTLLSGHSGFDRPSAVKTKESG----VGQININDLVGLKMRTIA-C.................................................................................................................................................................................................................. 250
5 -5.740sp|Q8NCS7|CTL5_HUMAN Choline transporter-like protein 5 OS=Homo sapiens GN=SLC44A5 PE=2 SV=2 (Range: 99-240)  ali follow..  10  1..........RCTSPSVLLNLQCPTTQICVSKCPE-DKSYWEDYRQFCKTTAKPVKSLTQLLDDDCPTA............................................................................................................................................................................................................... 73
6 -5.360sp|Q96F81|DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens GN=DISP1 PE=2 SV=3 (Range: 287-456)  ali follow..  10  20TSSGGETL-WNLPAIKSM----CNVDNSRIRSHPQFGDLNRSSCQKIVERDVSHTLKL----LRTCAKH............................................................................................................................................................................................................... 102
7 -4.980sp|Q6ZRI0|OTOG_HUMAN Otogelin OS=Homo sapiens GN=OTOG PE=2 SV=3 (Range: 2441-2829)  ali follow..  329PNGTTSLFLPGASWIADCARHHCSSTPLGA-----VLVRSPISCPPLNETECAKVGGSVVPSLEGC.................................................................................................................................................................................................................. 389
8 -4.690sp|Q5T7M9|FA69A_HUMAN Protein FAM69A OS=Homo sapiens GN=FAM69A PE=2 SV=1 (Range: 51-189)  ali follow..  17  2....................ELCRGKDCKKIICDKYKTGVIDGCNSL-------CVT-ETLYFGKC.................................................................................................................................................................................................................. 41
9 -4.620sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 (Range: 38-104)  ali follow..  12  4..............TAATPVHHCRPASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLD................................................................................................................................................................................................................ 60
10 -4.350sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 (Range: 1214-1423)  ali follow..  14  127...............TLVSIPVCNNSSVQVG-CLTRERLNVTWKSRLEDIPVASLPDLHDIERA----LVGKDLLGRFTDLIQSGSFQLHLDS....................................................................................................................................................................................... 201

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.