current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q6UXB0|F131A_HUMAN Protein FAM131A OS=Homo sapiens GN=FAM131A PE=2 SV=1 (Range: 22-106), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst EYMLGSPLSSLAQVNLSPFSHPKVHMDPNYCHPSTSLHLCSLAWSFTRLLHPPLSPGISQVVKDHVTKPTAMAQGRVAHLIEWKGLast
1 -79.500sp|Q6UXB0|F131A_HUMAN Protein FAM131A OS=Homo sapiens GN=FAM131A PE=2 SV=1 (Range: 22-106)  ali  100  1EYMLGSPLSSLAQVNLSPFSHPKVHMDPNYCHPSTSLHLCSLAWSFTRLLHPPLSPGISQVVKDHVTKPTAMAQGRVAHLIEWKG 85
2 -51.700sp|Q86XD5|F131B_HUMAN Protein FAM131B OS=Homo sapiens GN=FAM131B PE=1 SV=3 (Range: 25-90)  ali follow..  42  1...........SWDGINLSMEDTTSILPKL-------KRNSNAYGIGALAKSSFS-GISRSMKDHVTKPTAMGQGRVAHMIEWQG 66
3 -49.200sp|Q96AQ9|F131C_HUMAN Protein FAM131C OS=Homo sapiens GN=FAM131C PE=2 SV=2 (Range: 1-119)  ali follow..  36  50........MDFCWDPWQRCFQTTNGYLSDS-------RSRPGNYNVAALATSSLV-GVVQSIKDHITKPTAMARGRVAHLIEWKG 118
4 -7.580sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 (Range: 148-267)  ali follow..  38  108......................................................................AAQRGSLRYLLEW.. 120
5 -7.580tr|E7ENU6|E7ENU6_HUMAN Uncharacterized protein OS=Homo sapiens GN=HERC1 PE=4 SV=1 (Range: 148-267)  ali follow..  38  108......................................................................AAQRGSLRYLLEW.. 120
6 -7.390sp|Q96QE3|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens GN=ATAD5 PE=1 SV=4 (Range: 833-975)  ali follow..  25  3..................................................RDFLMSGLPDLLKRQIAKKAAALD-RVVHVQQ... 43
7 -5.800sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 (Range: 1-98)  ali follow..  15  12..YFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLP-HLIDHEAMSQGYVQHII.... 98
8 -5.710tr|B5MEH5|B5MEH5_HUMAN Uncharacterized protein OS=Homo sapiens GN=IZUMO2 PE=4 SV=1 (Range: 21-234)  ali follow..  22  148..........................RPATPRGPAVPDGQQIPEEPGAVGHPHFCVSGCLCLRGH-TKPTPAAVGR------WFG 208
9 -5.700sp|Q9P0W8|SPAT7_HUMAN Spermatogenesis-associated protein 7 OS=Homo sapiens GN=SPATA7 PE=2 SV=3 (Range: 366-440)  ali follow..  13  6.............................................IEDVTDEILKLGLERLFERHIKQNKHLEEEKMRHLLH... 48
10 -5.330sp|Q7Z4N2|TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens GN=TRPM1 PE=1 SV=2 (Range: 46-401)  ali follow..  14  46DWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAW----IFTGGVSTGVISHVGDALKDHSSKSRGRVCGIAPW.. 126

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.