current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q6ZNB7|ALKMO_HUMAN Alkylglycerol monooxygenase OS=Homo sapiens GN=AGMO PE=1 SV=1 (Range: 1-118), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLPSLFFRSIELTSYIYIWENYRLFNLPWDSPWTWYLast
1 -83.100sp|Q6ZNB7|ALKMO_HUMAN Alkylglycerol monooxygenase OS=Homo sapiens GN=AGMO PE=1 SV=1 (Range: 1-118)  ali  100  1MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLPSLFFRSIELTSYIYIWENYRLFNLPWDSPWTWY 118
2 -7.340sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 (Range: 293-448)  ali follow..  11  2....................YIFQPISASAKLYMNPYAESELKTPKLDCNIEIQNIAIELTKP----QYLSMID-------------LLESVDYMVRNAPYRKYKPYLPLHTNGRRWW 82
3 -7.120sp|C9JH25|PRRT4_HUMAN Proline-rich transmembrane protein 4 OS=Homo sapiens GN=PRRT4 PE=2 SV=1 (Range: 535-696)  ali follow..  1....................................................FKGATPLPQGRSPFAPRESWRRAARTAPVAGTFGLLSGALQGYEVLHALGYGG--QSGLEGPWPWW 64
4 -6.640sp|Q96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens GN=SECISBP2 PE=1 SV=2 (Range: 1-149)  ali follow..  12  1MASEGPREPESEGIKLSADVKPFVPRFLESSEACVFPSSAATYYPFV....................................................................... 54
5 -6.280sp|Q8WXG9|GPR98_HUMAN G-protein coupled receptor 98 OS=Homo sapiens GN=GPR98 PE=1 SV=2 (Range: 3471-3580)  ali follow..  7.............DQNSIDIFIWEMGQSSFRYFQSVDFAAVNRIHSFTPASGIAHILLIGQDMSALYCWNSERNQFSFSLNSSKNLIALVGAHSHIYELAY................. 110
6 -5.740sp|Q969R8|ITFG2_HUMAN Integrin-alpha FG-GAP repeat-containing protein 2 OS=Homo sapiens GN=ITFG2 PE=2 SV=1 (Range: 335-447)  ali follow..  12  10..................................................................FQVDENIRAFCAGLYACKEGRNSPCLVYVTFIYVYWEVQLERMESTN..... 59
7 -5.380sp|O75593|FOXH1_HUMAN Forkhead box protein H1 OS=Homo sapiens GN=FOXH1 PE=1 SV=1 (Range: 273-365)  ali follow..  13  44....ETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLL..................................................................... 88
8 -5.320sp|Q9BV29|CO057_HUMAN Uncharacterized protein C15orf57 OS=Homo sapiens GN=C15orf57 PE=2 SV=2 (Range: 63-159)  ali follow..  14  1........................PAVKPWAPLQDSEVYLAS----------LEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFL.............................. 54
9 -5.200sp|O43677|NDUC1_HUMAN NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial OS=Homo sapiens GN=NDUFC1 PE=2 SV=1 (Range: 1-76)  ali follow..  17  25...............VRSKFYVREPPNAK-------PDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL............................................. 75
10 -5.170sp|Q8N5Q1|F71E2_HUMAN Protein FAM71E2 OS=Homo sapiens GN=FAM71E2 PE=5 SV=3 (Range: 1-93)  ali follow..  20  38..............................................LRPLPMFESNFVQVTHQGGPVFVNHRTNRLAMGVAASLPGLVLPDILLIG...................... 87

FFAS is supported by the NIH grant R01-GM087218-01
1 2 9 7 3 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhi D, Krishna SS, Cao H, Pevzner P, Godzik A. Representing and comparing protein structures as paths in three-dimensionalspace. BMC Bioinformatics. 2006 Oct 20;7:460.