current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q86XR2|NIBL2_HUMAN Niban-like protein 2 OS=Homo sapiens GN=FAM129C PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst GIVLQRSQAPAARAFLDAVRLYRQHQGHFGDDDVTLGSDAEVLTAVLMREQLPALRAQTLPGLRGAGRARAWAWTELLDAVHAAVLAGASLast
1 -75.000sp|Q86XR2|NIBL2_HUMAN Niban-like protein 2 OS=Homo sapiens GN=FAM129C PE=1 SV=2  ali  100  1GIVLQRSQAPAARAFLDAVRLYRQHQGHFGDDDVTLGSDAEVLTAVLMREQLPALRAQTLPGLRGAGRARAWAWTELLDAVHAAVLAGAS 90
2 -31.800sp|Q96TA1|NIBL1_HUMAN Niban-like protein 1 OS=Homo sapiens GN=FAM129B PE=1 SV=3  ali   30  1...................RMYRQSKELYGTWEMLCGNEVQILSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAK 71
3 -6.450sp|Q9ULL8|SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens GN=SHROOM4 PE=1 SV=3  ali   15  1.......SECFASKGLENSMCCKPLHCGDFDYHRTCSYSCSVQGALVHDEICPALLKRNMMPNCYNCRCHHHQCIRCSVCYHN....... 83
4 -6.080sp|Q9UNS1|TIM_HUMAN Protein timeless homolog OS=Homo sapiens GN=TIMELESS PE=1 SV=2  ali   25  40.DCLLAGQAPQALTLLRSAREVWPEGDVFGSQDISPEEEIQLLKQILS.......................................... 86
5 -5.900sp|Q96P56|CTSR2_HUMAN Cation channel sperm-associated protein 2 OS=Homo sapiens GN=CATSPER2 PE=1 SV=2  ali   10  15.ADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELL---DPSRQKKLVLGDQHQLVRFSIKPQRIEQISHAQR.................. 82
6 -5.790sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3  ali   25  7.....KMQAVKEICYEVALADFRHGR-----------AEIEALAALKMRELC---------RTYGKPDGPGDAWRAVARDVWDTV..... 66
7 -5.780tr|A8MVV2|A8MVV2_HUMAN Uncharacterized protein OS=Homo sapiens PE=4 SV=1  ali   16  5.....KMQEVKKICYELALAYFHHGQ-----------AEIEALATLKVWELC---------HTYGKPEGPRDAWRAVARDFWDTV..... 64
8 -5.430sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2  ali   55...................................MNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMYH....... 102
9 -5.390sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=1 SV=2  ali   34..................................AAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ....... 82
10 -5.380sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4  ali   16  28......KSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSI................................... 76

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 2 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Berman HM, Burley SK, Chiu W, Sali A, Adzhubei A, Bourne PE, Bryant SH,Dunbrack RL Jr, Fidelis K, Frank J, Godzik A, Henrick K, Joachimiak A, HeymannB, Jones D, Markley JL, Moult J, Montelione GT, Orengo C, Rossmann MG, Rost B,Saibil H, Schwede T, Standley DM, Westbrook JD. Outcome of a workshop on archiving structural models of biological macromolecules. Structure. 2006 Aug;14(8):1211-7.