current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q92508|PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens GN=PIEZO1 PE=1 SV=4 (Range: 1753-1820), from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
1 -58.200sp|Q92508|PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens GN=PIEZO1 PE=1 SV=4 (Range: 1753-1820)  ali  100  1PWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLWDHEEDSPSKEHDKS 68
2 -45.500sp|Q9H5I5|PIEZ2_HUMAN Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens GN=PIEZO2 PE=2 SV=2 (Range: 1988-2040)  ali follow..  62  1PWNKNV--EVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWD............. 53
3 -7.520sp|Q96N23|CL055_HUMAN Uncharacterized protein C12orf55 OS=Homo sapiens GN=C12orf55 PE=2 SV=2 (Range: 713-812)  ali follow..  13  65............................NSFMMDLHLELIQAQHRIAVVLLDKLQGSIFLNSED.... 100
4 -6.940tr|E9PJL5|E9PJL5_HUMAN Uncharacterized protein OS=Homo sapiens GN=C12orf63 PE=4 SV=1 (Range: 713-806)  ali follow..  13  65............................NSFMMDLHLELIQAQHRIAVVLLDKLQVLQ.......... 94
5 -6.680sp|Q96M86|DNHD1_HUMAN Dynein heavy chain domain-containing protein 1 OS=Homo sapiens GN=DNHD1 PE=1 SV=2 (Range: 282-478)  ali follow..  11  27PYSLMVVPPDKVNPEHYIFSPFGITWHHHCVLWQQLQFIPFFKYCLLRKSFTCWKKNVRLQGLHRLQK 109
6 -6.460sp|Q92508|PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens GN=PIEZO1 PE=1 SV=4 (Range: 1060-1159)  ali follow..  10  9PWRWSRAVPMNSA--LYLPD-FFRAPNSTNLISDFLLLLCASQQWQVFS................... 58
7 -6.430tr|Q9UHT5|Q9UHT5_HUMAN HCG2032337 OS=Homo sapiens GN=hCG_2032337 PE=2 SV=1 (Range: 1-105)  ali follow..  56..........SSDPPTLASQSGGNRHEPPHRALKHIFLKHIWLFSFYFHQNG................ 97
8 -6.420sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 (Range: 2903-3013)  ali follow..  21  16...ISAVAQVKAFRSLWPSDIFGSCEDD-----PVQTLLHIYFHHQTLGQTGSF.............. 61
9 -6.380sp|Q8N187|AL2S8_HUMAN Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein OS=Homo sapiens GN=ALS2CR8 PE=2 SV=2 (Range: 161-239)  ali follow..  27  39.........LSSNTPIWACRLRSCEK-RGYCVSETELESVLTFHK....................... 78
10 -6.300sp|O95498|VNN2_HUMAN Vascular non-inflammatory molecule 2 OS=Homo sapiens GN=VNN2 PE=1 SV=3 (Range: 240-302)  ali follow..  20  3.................LPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTG................ 37

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.