current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q93073|SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens GN=SECISBP2L PE=2 SV=3, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MDRAPTEQNVKLSAEVEPFIPQKKSPDTFMIPMALPNDNGSVSGVEPTPIPSYLITCYPFVQENQSNRQFPLYNNDIRWQQPNPNPTGPYFAYPIISAQPPVSTEYTYYQLMPAPCAQVMGFYHPFPTPYSNTFQAANTVNAITTECTELast
1 -71.700sp|Q93073|SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens GN=SECISBP2L PE=2 SV=3  ali  100  1MDRAPTEQNVKLSAEVEPFIPQKKSPDTFMIPMALPNDNGSVSGVEPTPIPSYLITCYPFVQENQSNRQFPLYNNDIRWQQPNPNPTGPYFAYPIISAQPPVSTEYTYYQLMPAPCAQVMGFYHPFPTPYSNTFQAANTVNAITTECTE 149
2 -28.200sp|Q96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens GN=SECISBP2 PE=1 SV=2  ali   21  7..REPESEGIKLSADVKPFVPRFAGLNVAWLE-----------SSEACVFPSSAATYYPFVQEPPVTEQKIYTEDMAFGASTFPLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKT.... 147
3 -5.260sp|Q9H6R7|CB044_HUMAN WD repeat-containing protein C2orf44 OS=Homo sapiens GN=C2orf44 PE=1 SV=1  ali   33  47IEMLHDSHWILLSADSEGFIP................................................................................................................................ 67
4 -5.020sp|Q5VYS4|CM033_HUMAN Uncharacterized protein C13orf33 OS=Homo sapiens GN=C13orf33 PE=2 SV=1  ali   15  180.........RSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQ....................................................................................... 232
5 -4.850sp|Q9Y6J0|CABIN_HUMAN Calcineurin-binding protein cabin-1 OS=Homo sapiens GN=CABIN1 PE=1 SV=1  ali   15  103LPEFDSYKTSTVSADLANLLKRIATIVPRTERPALSLDKVSA--GTSTEVPCLPEGADP.......................................................................................... 162
6 -4.720sp|Q6ZNB7|ALKMO_HUMAN Alkylglycerol monooxygenase OS=Homo sapiens GN=AGMO PE=1 SV=1  ali   21  1MKNPEAQQDVSVSQGFRMLKPSETSFQ------------------TLEEVPDYVKKATPF......................................................................................... 46
7 -4.670sp|Q9UJA3|MCM8_HUMAN DNA replication licensing factor MCM8 OS=Homo sapiens GN=MCM8 PE=1 SV=2  ali   15  1.ERSQHGSGMSNRSTAKRFI................................................................................................................................. 19
8 -4.480sp|Q9Y2G0|EFR3B_HUMAN Protein EFR3 homolog B OS=Homo sapiens GN=EFR3B PE=2 SV=2  ali   25  165..GGSGYNSDRLCL---PYIP................................................................................................................................ 180
9 -4.310sp|Q9H0H0|INT2_HUMAN Integrator complex subunit 2 OS=Homo sapiens GN=INTS2 PE=1 SV=2  ali   23  26MQKVDVVCLASLSDELRLLLP................................................................................................................................ 47
10 -4.190sp|Q9BUU2|MET22_HUMAN Methyltransferase-like protein 22 OS=Homo sapiens GN=METTL22 PE=2 SV=2  ali   20  10MDEVTFRSDTVLS-DVHLYTPNHRHLMVRLNSVGQP................................................................................................................. 44

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 9 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.