current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: sp|Q96GM5|SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens GN=SMARCD1 PE=1 SV=2, from NEW_HUMAN_DOMAINS

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst PQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYLast
1 -94.100sp|Q96GM5|SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens GN=SMARCD1 PE=1 SV=2  ali  100  1PQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDY 157
2 -86.200sp|Q6STE5|SMRD3_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Homo sapiens GN=SMARCD3 PE=1 SV=1  ali   88  7PQRIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEGKLLDDP-------SKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDLSVRCTLLLMLDY 156
3 -41.500sp|Q92925|SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens GN=SMARCD2 PE=1 SV=3  ali   86  1...........................................................................LRVEGKLLDD-------PSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLD. 74
4 -33.500tr|F8VZ70|F8VZ70_HUMAN Uncharacterized protein OS=Homo sapiens GN=SMARCD1 PE=4 SV=1  ali   100  1.................................................................................................RKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDY 60
5 -7.810sp|Q8IWV8|UBR2_HUMAN E3 ubiquitin-protein ligase UBR2 OS=Homo sapiens GN=UBR2 PE=1 SV=1  ali   10  3PPVLPPFCPLFASLVNILQSD-CIMGTILQWAVEHNGYAWSESMLQRVLHLIGMALQEEKQHLENVTEEHVVTFTFTQKISKPGEAPKNS----------PSILAMLETLQNAPYLEVHKDMIRW................................ 119
6 -6.420sp|Q4G0P3|HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens GN=HYDIN PE=1 SV=3  ali   13  8PFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTIRAGESVRPKKINNITVSFEGNPSGSKTPPGEGSETGVKWVYYLKGITL.......................................................................... 100
7 -6.130sp|Q8TED9|AF1L1_HUMAN Actin filament-associated protein 1-like 1 OS=Homo sapiens GN=AFAP1L1 PE=2 SV=2  ali   27  7...LEQLLPELTGLLSLLDHE-YLSDTTLEKKMAVASILQS.................................................................................................................... 43
8 -6.100sp|Q9H8E8|CSR2B_HUMAN Cysteine-rich protein 2-binding protein OS=Homo sapiens GN=CSRP2BP PE=1 SV=3  ali   11  13.KRLEACPGAVAMTPEARRLKRKLIVRQAKRDFDLDQVVNAALLLVDGIYGAKEGGISRLPAGQATYRTTCQ------DFRILDRYQTSLPSRKGFRHQTTKFLYRLV................................................. 118
9 -6.020sp|A0JNW5|UH1BL_HUMAN UHRF1-binding protein 1-like OS=Homo sapiens GN=UHRF1BP1L PE=1 SV=2  ali   23PDGKDFPIPSPNLYSQLNALQFTVDERSIMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAISIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSC.................................... 160
10 -5.600sp|Q6BDS2|URFB1_HUMAN UHRF1-binding protein 1 OS=Homo sapiens GN=UHRF1BP1 PE=1 SV=1  ali   10  21PDNQELPVPCPNLYIQLNGLTFTMDPVSFKAIYKLEDSSQKDEHLDIRLDAFWLKVSFPLEKRERAELHRPQALVFSASGMIATNTRHAPHCSCSDLQSLFRGFAA................................................... 143

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.